DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu2 and eef2a.2

DIOPT Version :9

Sequence 1:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001038637.1 Gene:eef2a.2 / 568904 ZFINID:ZDB-GENE-050208-348 Length:853 Species:Danio rerio


Alignment Length:240 Identity:58/240 - (24%)
Similarity:94/240 - (39%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQ---IDRAPEEKARGITI--NACHIGYSTT 118
            |:..||..||||:|||..:.   |:.|:.......:   :|...:|:.|.|||  .|..|.|...
Zfish    21 NMSVIGAFDHGKSTLTDWLV---SKAGIVSSACAGETRFMDTRRDEQERCITIKSTAISIFYELA 82

  Fly   119 ERTYAH--------------TDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAK 169
            ::..|.              .|.|||.|:...:.:.....|||:|||....|...||  ..:|.:
Zfish    83 DKDLAFIKECKDGSGFLLNLIDSPGHVDFSSEVTAALRITDGALLVVDCVSGVCLQT--ETVLRQ 145

  Fly   170 QVGIQRI--IVFINKADLVDQEVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKSEFGV 232
            .:| :||  ::.|||   :|:.:||| ::...|:...|                           
Zfish   146 AIG-ERIKPVLMINK---MDRALLEL-QLVPEELYQIF--------------------------- 178

  Fly   233 PSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGT 277
               ::::|:.:..|.|...|...    |:.|....|..|.:..|:
Zfish   179 ---QRIVEKVNVTISTYAEDEKG----PMGNVMIDPVVGNLAFGS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 58/240 (24%)
EF_Tu 56..249 CDD:206671 51/210 (24%)
EFTU_II 257..343 CDD:293898 5/21 (24%)
mtEFTU_III 347..437 CDD:294005
eef2a.2NP_001038637.1 PTZ00416 1..852 CDD:240409 58/240 (24%)
EF2 20..233 CDD:206672 58/240 (24%)
Translation_Factor_II_like 392..486 CDD:295476
EF2_snRNP_III 511..563 CDD:293918
aeEF2_snRNP_like_IV 573..741 CDD:238839
eEF2_snRNP_like_C 737..816 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592494
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.