DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu2 and CG4849

DIOPT Version :9

Sequence 1:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_651605.1 Gene:CG4849 / 43358 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster


Alignment Length:210 Identity:60/210 - (28%)
Similarity:86/210 - (40%) Gaps:31/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGTIGHVDHGKTTLTAAITR-IQSQKGLAEYLSYDQIDRAPEEKARGITINACHIG---YSTTE 119
            ||..:||:.|||||....:.| ...|....|.......|....|:.||.:|.|..:.   ....:
  Fly   133 NVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDVKQ 197

  Fly   120 RTYAHT--DCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRIIVFINK 182
            ::|...  |.|||.::.....:.....||.:|.:.|.:|.|..| |.||.......|.|.|.|||
  Fly   198 KSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNT-ERLLKHAVQERQAITVCINK 261

  Fly   183 ADLVDQEVLEL--------------VEIEMREMLSDFGFDGVN---SPVICGSALLALREDKSEF 230
               :|:.:|||              || |:..:||.:|....|   ||:: |:...|.......|
  Fly   262 ---IDRLILELKLPPQDAYFKLKHIVE-EVNGLLSTYGAPDDNLLVSPIL-GNVCFASSLYGFCF 321

  Fly   231 GVPSIEKLLEQCDSY 245
            .:.|..||  ..|:|
  Fly   322 TLKSFAKL--YADTY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 60/210 (29%)
EF_Tu 56..249 CDD:206671 60/210 (29%)
EFTU_II 257..343 CDD:293898
mtEFTU_III 347..437 CDD:294005
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 60/210 (29%)
Snu114p 132..340 CDD:206730 60/210 (29%)
Translation_Factor_II_like 477..568 CDD:295476
snRNP_III 589..660 CDD:293921
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.