DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu2 and eIF2gamma

DIOPT Version :9

Sequence 1:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:379 Identity:100/379 - (26%)
Similarity:153/379 - (40%) Gaps:108/379 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYSTTE---- 119
            |:||||||.|||:|:..||:.:|:.             |...|..|.|||.   :||:..:    
  Fly    42 NIGTIGHVAHGKSTVVKAISGVQTV-------------RFKNELERNITIK---LGYANAKIYKC 90

  Fly   120 ------------------------------------RTYAHTDCPGHADYIKNMISGASQMDGAI 148
                                                |..:..|||||...:..|::||:.||.|:
  Fly    91 DNPKCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAAL 155

  Fly   149 LVVAATDG-QMPQTREHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDF--GFDGV 210
            |::|..:. ..|||.|||...:.:.:::|::..||.||:.:...:    |..|.::.|  |....
  Fly   156 LLIAGNESCPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAK----EQYEEITKFVQGTVAE 216

  Fly   211 NSPVICGSALLALREDKSEFGVPSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTV--PG---- 269
            .:|:|..||.|..          :|:.|.|...:.||.|.||.::|..|.:..:|.|  ||    
  Fly   217 GAPIIPISAQLKY----------NIDVLCEYIVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVA 271

  Fly   270 --RGTVVVGTIKRGTIPRNADADLLGFNQNLKTSISD------------IQIF--RKSVPQAQAG 318
              :|.|..|:|..|.:....:.::   ...:.|..||            :.:|  :..:..|..|
  Fly   272 DLKGGVAGGSILSGVLKVGQEIEV---RPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPG 333

  Fly   319 ENVGALLRGIKIS----AVER--GMLLCATGS-EDISNHFEGSMYLLSRAEGGR 365
            ..:|.   |.||.    ..:|  |.:|.|.|. .||....|.|.|||.|..|.|
  Fly   334 GLIGV---GTKIDPTLCRADRLVGQVLGAVGQLPDIYQELEISYYLLRRLLGVR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 100/379 (26%)
EF_Tu 56..249 CDD:206671 61/232 (26%)
EFTU_II 257..343 CDD:293898 24/113 (21%)
mtEFTU_III 347..437 CDD:294005 9/19 (47%)
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 100/379 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.