DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu2 and eEFSec

DIOPT Version :9

Sequence 1:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster


Alignment Length:333 Identity:91/333 - (27%)
Similarity:155/333 - (46%) Gaps:64/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQIDRAPEEKARGITINACHIGYS------- 116
            |:|.:||||.|||||..|::.|.|...         .|:.|:...||||::   :|:|       
  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTAA---------FDKNPQSVERGITLD---LGFSGLLVDAP 58

  Fly   117 -----TTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHLLLAKQVGIQRI 176
                 ..:..:...||||||..|:.:|.||..:|..:|||.|..|:..||.|.|::.:.:. :::
  Fly    59 AHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQ-KKL 122

  Fly   177 IVFINKADLVDQ----EVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKSEFGVPSIEK 237
            ||.|||.|:..:    ..||.:.:.:.:.|....|.| ..|:...|||....       :..:.:
  Fly   123 IVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFGG-QVPICAVSALQGTH-------IAELRE 179

  Fly   238 LLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGTIKRGTIPRNADADLLGFNQNLKTSI 302
            :|.  ::|. .|||:::.|..:.:|:.|.:.|:|||..||:.:|.:..|...:|....:..|  :
  Fly   180 VLR--EAYF-QPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRK--V 239

  Fly   303 SDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDISNHFEGSMYLLSRAEGGRVK 367
            ..||:|||:|..|..|:.:|..:.......:|||::                      .:.|.:|
  Fly   240 KSIQMFRKNVTSASMGDRIGLCVTQFNAKLLERGII----------------------TQPGYLK 282

  Fly   368 PMLSKYIQ 375
            |:.:..:|
  Fly   283 PIYAVCLQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 91/333 (27%)
EF_Tu 56..249 CDD:206671 59/205 (29%)
EFTU_II 257..343 CDD:293898 24/85 (28%)
mtEFTU_III 347..437 CDD:294005 4/29 (14%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 62/209 (30%)
SelB 6..467 CDD:225815 91/333 (27%)
SelB_II 196..278 CDD:293897 24/105 (23%)
eSelB_III 283..396 CDD:294009 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.