DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu2 and eEF2

DIOPT Version :9

Sequence 1:NP_610288.1 Gene:mEFTu2 / 35681 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_525105.2 Gene:eEF2 / 35422 FlyBaseID:FBgn0000559 Length:844 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:94/244 - (38%) Gaps:70/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NVGTIGHVDHGKTTLTAAITRIQSQKGLAEYLSYDQ---IDRAPEEKARGITINACHIG--YSTT 118
            |:..|.||||||:|||.::.   |:.|:.......:   .|...:|:.|.|||.:..|.  :...
  Fly    21 NMSVIAHVDHGKSTLTDSLV---SKAGIIAGAKAGETRFTDTRKDEQERCITIKSTAISMYFEVE 82

  Fly   119 ERTYAH------------------TDCPGHADYIKNMISGASQMDGAILVVAATDGQMPQTREHL 165
            |:....                  .|.|||.|:...:.:.....|||::||....|...||...|
  Fly    83 EKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVL 147

  Fly   166 LLAKQVGIQRI--IVFINKADLVDQEVLELVEIEMREMLSDFGFDGVNSPVICGSALLALREDKS 228
               :|...:||  |:|:||   :|:.:||| :::..|:...|                       
  Fly   148 ---RQAIAERIKPILFMNK---MDRALLEL-QLDAEELYQTF----------------------- 182

  Fly   229 EFGVPSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGT 277
                   ::::|..:..|.|...|..     |:......|.:|:|..|:
  Fly   183 -------QRIVENVNVIIATYNDDGG-----PMGEVRVDPSKGSVGFGS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 57/244 (23%)
EF_Tu 56..249 CDD:206671 50/214 (23%)
EFTU_II 257..343 CDD:293898 5/21 (24%)
mtEFTU_III 347..437 CDD:294005
eEF2NP_525105.2 PTZ00416 1..844 CDD:240409 57/244 (23%)
EF2 20..236 CDD:206672 57/244 (23%)
EF2_snRNP_like_II 380..474 CDD:293901
EF2_snRNP_III 489..560 CDD:293918
aeEF2_snRNP_like_IV 560..732 CDD:238839
eEF2_snRNP_like_C 728..807 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.