DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment didum and AT1G42680

DIOPT Version :9

Sequence 1:NP_724569.1 Gene:didum / 35680 FlyBaseID:FBgn0261397 Length:1800 Species:Drosophila melanogaster
Sequence 2:NP_174989.2 Gene:AT1G42680 / 840876 AraportID:AT1G42680 Length:170 Species:Arabidopsis thaliana


Alignment Length:98 Identity:48/98 - (48%)
Similarity:66/98 - (67%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LSIIVSGESGAGKTVSAKYAMRYFAAVGGSESETQVERKVLASSPIMEAFGNAKTTRNDNSSRFG 222
            :|...|||||||||.:.|.||:|.||:||...   :|.::|.::||:||||||||.|||||||||
plant    51 ISFSSSGESGAGKTETTKIAMQYLAALGGGSG---IEYEILKTNPILEAFGNAKTLRNDNSSRFG 112

  Fly   223 KFTKLLFRNQMGVMFLQGATMHTYLLEKSRVVY 255
            |..::.| ::.|.  :.||.:.|:   ||..:|
plant   113 KLIEIHF-SETGK--ISGAQIQTF---KSGSMY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
didumNP_724569.1 MYSc 65..778 CDD:214580 48/98 (49%)
MYSc_Myo5 84..767 CDD:276831 48/98 (49%)
IQ 900..922 CDD:197470
GBP_C <971..1086 CDD:303769
coiled coil 1049..1068 CDD:293879
coiled coil 1077..1086 CDD:293879
JAKMIP_CC3 <1190..1299 CDD:292653
Myo5_CBD 1424..1792 CDD:271254
AT1G42680NP_174989.2 PH-like <21..>55 CDD:302622 1/3 (33%)
Motor_domain 56..>134 CDD:277568 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.