DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment didum and AT1G42680

DIOPT Version :10

Sequence 1:NP_724569.1 Gene:didum / 35680 FlyBaseID:FBgn0261397 Length:1800 Species:Drosophila melanogaster
Sequence 2:NP_174989.2 Gene:AT1G42680 / 840876 AraportID:AT1G42680 Length:170 Species:Arabidopsis thaliana


Alignment Length:98 Identity:48/98 - (48%)
Similarity:66/98 - (67%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LSIIVSGESGAGKTVSAKYAMRYFAAVGGSESETQVERKVLASSPIMEAFGNAKTTRNDNSSRFG 222
            :|...|||||||||.:.|.||:|.||:||...   :|.::|.::||:||||||||.|||||||||
plant    51 ISFSSSGESGAGKTETTKIAMQYLAALGGGSG---IEYEILKTNPILEAFGNAKTLRNDNSSRFG 112

  Fly   223 KFTKLLFRNQMGVMFLQGATMHTYLLEKSRVVY 255
            |..::.| ::.|.  :.||.:.|:   ||..:|
plant   113 KLIEIHF-SETGK--ISGAQIQTF---KSGSMY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
didumNP_724569.1 MYSc_Myo5 84..767 CDD:276831 48/98 (49%)
IQ 900..922 CDD:197470
SMC_prok_B <942..1365 CDD:274008
Myo5_CBD 1424..1792 CDD:271254
AT1G42680NP_174989.2 PH-like <21..>55 CDD:473070 1/3 (33%)
Motor_domain 56..>134 CDD:473979 44/86 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.