DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment didum and Rasip1

DIOPT Version :9

Sequence 1:NP_724569.1 Gene:didum / 35680 FlyBaseID:FBgn0261397 Length:1800 Species:Drosophila melanogaster
Sequence 2:XP_006229092.1 Gene:Rasip1 / 292912 RGDID:1305291 Length:960 Species:Rattus norvegicus


Alignment Length:368 Identity:81/368 - (22%)
Similarity:137/368 - (37%) Gaps:87/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1417 LMKFHSSDLDKILQRLLSALTPRTVVGLLPGF-PAYLIFMCIRYTDLTNADDDVRELLSKFVIQI 1480
            :::|...:.:.:|..::.|..  :..|.||.. ||.|:.:|::::........:..||.:....|
  Rat   537 VLRFRPREEEALLGEIVRAAA--SGAGDLPPLGPATLLALCVQHSARELELGHLPRLLGRLARLI 599

  Fly  1481 KKM---------HRTP--HP--------------IENR--VIWLVNSITLLNLMKQYGDVDEYVK 1518
            |:.         .|.|  ||              :|.|  ::|:.|:..||:.      |.|.| 
  Rat   600 KEAVWEKIKEIGDRQPENHPEGVPEVPLTPEAVSVELRPLILWMANTTELLSF------VQEKV- 657

  Fly  1519 FNTEKQNQQ-------QLKN-FNLFEYRRVILD-LIVNLYQALIMQIQGLLDPKIVPAILNNDEI 1574
            ...||:..|       ||.| ..|.:....:|| :|:..:|..:..:...| ...:||:|:::..
  Rat   658 LEMEKEADQEGLSSDPQLCNDLELCDEALALLDEVIMCTFQQSVYYLTKTL-YSTLPALLDSNPF 721

  Fly  1575 QRGRQAHGMRSRATSIGASSSPEHGGGPAWKQLIGQLEHFYKQFQHFGLDNCYAEQIFHQLLYFI 1639
            ..|.:..|..:...::.....|..|...|..:|..|.|          |......|.|..|.:|.
  Rat   722 TAGAELPGPGAELEAMPPGLRPTLGVFQAALELTSQCE----------LHPDLVSQTFGYLFFFS 776

  Fly  1640 CAVALNCLMLRGD---ICMWETGMIIRYNIGCIEDWVRSKKMSNDVLTALAPLNQVSQLLQSRKS 1701
            .|..||.||.||.   ...|...:.||.|:..:.||::...: .|:.|..           .||.
  Rat   777 NASLLNSLMERGQGRPFYQWSRAVQIRTNLDLVLDWLQGAGL-GDIATEF-----------FRKL 829

  Fly  1702 EQDVQTICDLCTS---------------LSTAQVLKVMKSYKL 1729
            ...|..:|...||               |:.||:..::..|:|
  Rat   830 SIAVNLLCVPRTSLLKASWSSLRTDYPTLTPAQLHHLLSHYQL 872

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
didumNP_724569.1 MYSc 65..778 CDD:214580
MYSc_Myo5 84..767 CDD:276831
IQ 900..922 CDD:197470
GBP_C <971..1086 CDD:303769
coiled coil 1049..1068 CDD:293879
coiled coil 1077..1086 CDD:293879
JAKMIP_CC3 <1190..1299 CDD:292653
Myo5_CBD 1424..1792 CDD:271254 80/361 (22%)
Rasip1XP_006229092.1 Ubiquitin_like_fold 130..249 CDD:421700
Myo5p-like_CBD_Rasip1 544..910 CDD:271256 80/361 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.