DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and Rcor3

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001128457.1 Gene:Rcor3 / 684192 RGDID:1593864 Length:551 Species:Rattus norvegicus


Alignment Length:287 Identity:61/287 - (21%)
Similarity:104/287 - (36%) Gaps:96/287 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 EEESESELDDARKII--MVGHDYQAEIPE---GLSQYGDILPYENEDQLIWEP-SQVSEREVEEY 319
            |.||....||....:  .||.:|||.|||   |.::|.|   .:|...|:|.| ..:.:.:::||
  Rat    41 EPESGCSSDDEHGDVGMRVGAEYQARIPEFDPGATKYTD---KDNGGMLVWSPYHSIPDAKLDEY 102

  Fly   320 LAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQELVVKDNE 384
            :|..:|..                    |..:                                |
  Rat   103 VAIAKEKH--------------------GYNV--------------------------------E 115

  Fly   385 QALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQNQVRTRT 449
            |||.:|....::.:::| ....|..|..|   .|:.::.:.||:.....||.|::|:| .:..:|
  Rat   116 QALGMLFWHKHNIEKSL-ADLPNFTPFPD---EWTVEDKVLFEQAFSFHGKSFHRIQQ-MLPDKT 175

  Fly   450 MRELVHFYYLWKKSERRDQSFALNDTIDHMDVFINEAGGGNGSGNGNGAGIVSGTANSNGSCSPH 514
            :..||.:||.|||:..|...         ||....:....:..|:           :.:....||
  Rat   176 IASLVKYYYSWKKTRSRTSL---------MDRQARKLANRHNQGD-----------SDDDVEEPH 220

  Fly   515 SSNGHSNGDLSALEKDTIASPRKPASK 541
            ..:|:          |:...|:|.|.:
  Rat   221 PMDGN----------DSDYDPKKEAKR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 16/50 (32%)
SANT 417..463 CDD:197842 15/45 (33%)
SANT_MTA3_like 417..462 CDD:212559 14/44 (32%)
Rcor3NP_001128457.1 ELM2 57..108 CDD:279754 18/53 (34%)
SANT 143..189 CDD:197842 16/49 (33%)
SANT 144..188 CDD:304392 14/44 (32%)
SANT 345..390 CDD:197842
Myb_DNA-binding 345..388 CDD:278669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.