DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and Zfp541

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001092747.1 Gene:Zfp541 / 666528 MGIID:3647699 Length:1363 Species:Mus musculus


Alignment Length:431 Identity:90/431 - (20%)
Similarity:149/431 - (34%) Gaps:148/431 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EEEALADMEAHSAEDEIATLREESEMPIEELLAKYGGTAASPAMSSSNRSGSSSRRARRATKRQY 152
            ||.|:.||:.|..    .:..|..::.|..:|...|....:|.:.||...|              
Mouse   890 EEGAVEDMKRHYD----CSSSEPQDVTILSMLVSSGSCGVTPVVLSSLLQG-------------- 936

  Fly   153 QELDTEMAHTSTSTSSSTSQLEKHDGIDQEEEPKEEADKLASPP------ESGEASSVDTEDAQK 211
            ||.|.|     ...|..:.|..|     :::.|:.:|  |.:||      |.|....        
Mouse   937 QEKDGE-----ERDSKESCQYRK-----RKKRPQPKA--LFAPPAPSALGEPGPGGC-------- 981

  Fly   212 YEGIKKQHRS----------HLL-DLYPDESFVD---LAP-----------TCGEETERFTP--L 249
                   |:|          ||| .|:....:..   |:|           .|  .|.|..|  :
Mouse   982 -------HQSCLHSPVFLVDHLLKGLFQCSPYTPPPMLSPIREGSGLYFNTLC--STSRAGPHLI 1037

  Fly   250 QTLFDEVEAE-----EEEESESELDDARKIIMVGHDYQAEIPEGLSQYGDILPYENEDQLIWEP- 308
            ..:.|:|::.     .:::::..::..   |.||..:|||||| |.:.......||...|:|:| 
Mouse  1038 SPVLDQVDSSFGICVVKDDTKISIEPH---INVGSRFQAEIPE-LQERLLARVDENVASLVWKPW 1098

  Fly   309 -SQVSEREVEEYLAKIQETR-SIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATS 371
             ..::..|.::.:.::.... |.|.|..|:..                                 
Mouse  1099 GDVMTNPETQDRVMELCNVACSSVMPGGGTNL--------------------------------- 1130

  Fly   372 GAGDQELVVKDNEQALHLLVQCGYDFKEALRR------KRMNVLPLTD---TMSS-WSEDECLKF 426
                        |.|||.|.......:.||..      ::....||.|   |.|. |:..|...|
Mouse  1131 ------------ELALHCLHDAQGSVQVALETLLLRGPQKPRTHPLADYRYTGSDIWTPMEKRLF 1183

  Fly   427 EEGIQRFGKDFYQIRQNQVRTRTMRELVHFYYLWKKSERRD 467
            ::......||||.|.: .::|:::.:.|.:||:|||..:.|
Mouse  1184 KKAFCAHKKDFYLIHK-MIQTKSVAQCVEYYYIWKKMVKFD 1223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 16/46 (35%)
SANT 417..463 CDD:197842 14/46 (30%)
SANT_MTA3_like 417..462 CDD:212559 13/45 (29%)
Zfp541NP_001092747.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
COG5236 <80..>329 CDD:227561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..137
C2H2 Zn finger 142..162 CDD:275368
zf-C2H2 142..162 CDD:278523
zf-H2C2_2 154..179 CDD:290200
zf-C2H2_6 168..192 CDD:290623
C2H2 Zn finger 170..190 CDD:275368
C2H2 Zn finger 198..216 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..387
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 440..532
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..741
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 935..978 14/68 (21%)
ELM2 1065..1120 CDD:279754 16/55 (29%)
SANT 1175..1219 CDD:197842 14/44 (32%)
SANT 1175..1218 CDD:304392 13/43 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1243..1298
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1343..1363
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.