DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and RCOR1

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_055971.2 Gene:RCOR1 / 23186 HGNCID:17441 Length:485 Species:Homo sapiens


Alignment Length:250 Identity:57/250 - (22%)
Similarity:93/250 - (37%) Gaps:85/250 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 EEEESESELDDAR--KIIMVGHDYQAEIPE-------GLSQYGDILPYENEDQLIWEPSQ-VSER 314
            ||..|.|..|:..  ..:.||..|||.:|:       ..||..|     |...|:|.|:| :||.
Human    88 EEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERD-----NLGMLVWSPNQNLSEA 147

  Fly   315 EVEEYLAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQELV 379
            :::||:|..:|....                                                  
Human   148 KLDEYIAIAKEKHGY-------------------------------------------------- 162

  Fly   380 VKDNEQALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQNQ 444
              :.||||.:|....::.:::| ....|..|..|   .|:.::.:.||:.....||.|::|:| .
Human   163 --NMEQALGMLFWHKHNIEKSL-ADLPNFTPFPD---EWTVEDKVLFEQAFSFHGKTFHRIQQ-M 220

  Fly   445 VRTRTMRELVHFYYLWKKS---------ERRDQSFALNDTIDHMDVFINEAGGGN 490
            :..:::..||.|||.|||:         ..|.|.....::.|.::    ||.|.|
Human   221 LPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELE----EANGNN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 17/52 (33%)
SANT 417..463 CDD:197842 15/45 (33%)
SANT_MTA3_like 417..462 CDD:212559 14/44 (32%)
RCOR1NP_055971.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..110 7/21 (33%)
Interaction with HDAC1. /evidence=ECO:0000269|PubMed:11516394 78..257 52/230 (23%)
ELM2 105..158 CDD:307553 19/57 (33%)
SANT 194..238 CDD:328756 14/44 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..314 6/31 (19%)
Interaction with KDM1A. /evidence=ECO:0000269|PubMed:16885027 296..384
Myb_DNA-binding 385..428 CDD:306708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 442..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.