DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and Rcor2

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_006526614.1 Gene:Rcor2 / 104383 MGIID:1859854 Length:532 Species:Mus musculus


Alignment Length:328 Identity:72/328 - (21%)
Similarity:116/328 - (35%) Gaps:92/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 EVEAEEEEESE---SELDDARKIIMVGHDYQAEI----PEGLSQYGDILPYENEDQLIWEPSQ-V 311
            |.::.|||.|.   :.......:|.||.:|||.|    ||..::|.:   .|.:..|:|.|:. |
Mouse    32 EDDSSEEEHSHVLTASPGSTDSMIRVGTNYQAVIPECKPESPARYSN---KELKGMLVWSPNHCV 93

  Fly   312 SEREVEEYLAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQ 376
            |:.::::|:|..:|..                    |..|                         
Mouse    94 SDAKLDKYIAMAKEKH--------------------GYNI------------------------- 113

  Fly   377 ELVVKDNEQALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIR 441
                   ||||.:|:...:|.:::| ....|..|..|   .|:.::.:.||:.....||.|.:|:
Mouse   114 -------EQALGMLLWHKHDVEKSL-ADLANFTPFPD---EWTVEDKVLFEQAFGFHGKCFQRIQ 167

  Fly   442 QNQVRTRTMRELVHFYYLWKKSERRDQSFALNDTIDHMDVFINEAGGGNGSGNGN----GAGIVS 502
            | .:..:.:..||.:||.|||:..|...         ||......||.....:.:    |.|.||
Mouse   168 Q-MLPDKVIPSLVKYYYSWKKTRSRTSV---------MDRQARRLGGRKDKEDSDELEEGRGAVS 222

  Fly   503 GTANSNGS----------CSPHSSNGHSNGDLSALEKDTIASPRKPASKSYSIMTGSQAV-GNPS 556
            ......|.          .:.....|.....:|......:.:.|:|....|....|..|| |:|.
Mouse   223 EGEPDTGDPKREPLPSRPLNARPGPGKKEVQISQYRHHPLRTRRRPPKGMYLSPEGLTAVSGSPD 287

  Fly   557 GGN 559
            ..|
Mouse   288 LAN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 16/49 (33%)
SANT 417..463 CDD:197842 14/45 (31%)
SANT_MTA3_like 417..462 CDD:212559 13/44 (30%)
Rcor2XP_006526614.1 ELM2 55..107 CDD:366648 18/54 (33%)
SANT 143..187 CDD:389774 13/44 (30%)
Myb_DNA-binding 340..383 CDD:365977
PRK12323 <399..>531 CDD:237057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12445
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.