DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and Rcor1

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_017449463.2 Gene:Rcor1 / 102554884 RGDID:7505493 Length:481 Species:Rattus norvegicus


Alignment Length:381 Identity:77/381 - (20%)
Similarity:122/381 - (32%) Gaps:135/381 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 PAMSSSNRSGSSSRRARRATKRQYQELDTEMAHTSTSTSSSTSQLEKHDGIDQEEEPKEEADKLA 193
            |||.......|..||.|          :|..|..|.:.:|:.|                .|...|
  Rat     2 PAMVEKGPEVSGKRRGR----------NTASAAASAAAASAAS----------------AAASAA 40

  Fly   194 SPPESGEASSVDTEDAQKYEGIKKQHRSHLLDLYPDESFVDLAPTCGEETERFTPLQTLFDEVEA 258
            :...:..||:..|..|.                        .||..|:................:
  Rat    41 ASAGTASASAAATASAA------------------------AAPNNGQNKSLAAAAPNGNSGSNS 81

  Fly   259 EEEEESESELDDAR--KIIMVGHDYQAEIPE-------GLSQYGDILPYENEDQLIWEPSQ-VSE 313
            .||..|.|..|:..  ..:.||..|||.:|:       ..||..|     |...|:|.|:| :||
  Rat    82 WEEGSSGSSSDEEHGGGGMRVGPQYQAAVPDFDPAKLARRSQERD-----NLGMLVWSPNQSLSE 141

  Fly   314 REVEEYLAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQEL 378
            .:::||:|..:|....                                                 
  Rat   142 AKLDEYIAIAKEKHGY------------------------------------------------- 157

  Fly   379 VVKDNEQALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQN 443
               :.||||.:|....::.:::| ....|..|..|   .|:.::.:.||:.....||.|::|:| 
  Rat   158 ---NMEQALGMLFWHKHNIEKSL-ADLPNFTPFPD---EWTVEDKVLFEQAFSFHGKTFHRIQQ- 214

  Fly   444 QVRTRTMRELVHFYYLWKKS---------ERRDQSFALNDTIDHMDVFINEAGGGN 490
            .:..:::..||.|||.|||:         ..|.|.....::.|.::    |..|.|
  Rat   215 MLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELE----EPNGSN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 17/52 (33%)
SANT 417..463 CDD:197842 15/45 (33%)
SANT_MTA3_like 417..462 CDD:212559 14/44 (32%)
Rcor1XP_017449463.2 ELM2 100..153 CDD:396160 19/57 (33%)
SANT 189..233 CDD:419695 14/44 (32%)
Myb_DNA-binding 380..423 CDD:395191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.