DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and mier2

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_002939806.1 Gene:mier2 / 100486492 XenbaseID:XB-GENE-5861536 Length:322 Species:Xenopus tropicalis


Alignment Length:323 Identity:92/323 - (28%)
Similarity:137/323 - (42%) Gaps:89/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AEEEEESESELDDARKIIMVGHDYQAEIPEGLSQYGDILP----YENEDQLIWEPSQVSEREVEE 318
            |:|:...||...:...:    |..:|::|.  .:|  |.|    ::.:|||:|:|:.:.|:||||
 Frog    19 AQEDWTLESSRVEEETL----HSCRAQLPN--LRY--IPPAERDFDEKDQLLWDPNVLPEQEVEE 75

  Fly   319 YLAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQELVVKDN 383
            ||.::.|.                :..|.||.:..                           .||
 Frog    76 YLIRVSEL----------------QHRAGGAYVRD---------------------------ADN 97

  Fly   384 EQALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQNQVRTR 448
            ||||:.||:||::.:|||||...||..:...:|:|||||...||.|.:..||:|:.|:.|:||||
 Frog    98 EQALYELVKCGFNSEEALRRLHFNVKVVQGGLSAWSEDERRHFEHGFRVHGKNFHLIQANKVRTR 162

  Fly   449 TMRELVHFYYLWKKSERR-------------------DQSFALND----TIDHMDVFINEAGGGN 490
            ::.|.|.:||.||||||.                   :..|.|.:    |..|..||..|..|..
 Frog   163 SVGECVQYYYFWKKSERYEFFRQSRLGKRKFGNPPSVENEFELPEPVCPTKVHKSVFRGELLGQT 227

  Fly   491 GSGNGNGAGI-VSGTANSNGSC-----SPHSSNGHS-----NGDLSALEKDTIASPRKPASKS 542
            .....|.... ....:..:.||     |..:|:|:.     .|||.:|.......|..|..|:
 Frog   228 AITQRNSPNYSTCSCSKDHCSCGMRRQSGANSSGYQESPPITGDLISLNFSQQTLPLLPGLKA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 16/48 (33%)
SANT 417..463 CDD:197842 23/45 (51%)
SANT_MTA3_like 417..462 CDD:212559 22/44 (50%)
mier2XP_002939806.1 ELM2 40..82 CDD:366648 17/45 (38%)
SANT_MTA3_like 132..176 CDD:212559 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062529at2759
OrthoFinder 1 1.000 - - FOG0001261
OrthoInspector 1 1.000 - - otm47638
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.