DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1620 and rcor2

DIOPT Version :9

Sequence 1:NP_001260777.1 Gene:CG1620 / 35678 FlyBaseID:FBgn0033183 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_012808982.1 Gene:rcor2 / 100038078 XenbaseID:XB-GENE-482248 Length:499 Species:Xenopus tropicalis


Alignment Length:219 Identity:57/219 - (26%)
Similarity:89/219 - (40%) Gaps:68/219 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 DEVEAEEEEESESELDDARK--IIMVGHDYQAEIPEGLSQYGDILPYEN---EDQLIWEPSQ-VS 312
            |.:...|||.||   |:|.:  :|.||.||||:|||...:|..  |..|   :..|:|.||| ||
 Frog    23 DSLGNSEEESSE---DEAPRDSMIRVGSDYQAQIPECKPEYSS--PSSNVELKGMLVWSPSQFVS 82

  Fly   313 EREVEEYLAKIQETRSIVPPDDGSETTAGEEGAATGATIEPPAPITAPATPPRAPLATSGAGDQE 377
            :.::.||:...:|..                    |..:                          
 Frog    83 DAKLNEYITMAKEKH--------------------GYNV-------------------------- 101

  Fly   378 LVVKDNEQALHLLVQCGYDFKEALRRKRMNVLPLTDTMSSWSEDECLKFEEGIQRFGKDFYQIRQ 442
                  ||||.:|:...:|.:.:|    .::...|.....||.::.:.||:.....||.|.:|:|
 Frog   102 ------EQALGMLLWHKHDVERSL----ADLANFTPFPEEWSVEDKVLFEQAFSFHGKCFQRIQQ 156

  Fly   443 NQVRTRTMRELVHFYYLWKKSERR 466
             .:..:.:..||.:||.|||:..|
 Frog   157 -MLPDKLIPSLVKYYYSWKKTRSR 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1620NP_001260777.1 ELM2 275..320 CDD:279754 21/48 (44%)
SANT 417..463 CDD:197842 15/45 (33%)
SANT_MTA3_like 417..462 CDD:212559 14/44 (32%)
rcor2XP_012808982.1 ELM2 43..95 CDD:366648 22/53 (42%)
SANT 131..175 CDD:389774 14/44 (32%)
Myb_DNA-binding 331..374 CDD:365977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.