DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and Adf1

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:265 Identity:56/265 - (21%)
Similarity:100/265 - (37%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLSN 107
            ||.||...|:::.|::.|.:........|.::.:.:.:|...|..:|..|||.|.:   ...|..
  Fly    16 LIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAR---EMKLCQ 77

  Fly   108 ETPSSWRFYNDMRFMEPAV---HENIMRQTRSSSKKHPPGHWTENNNVLGPDKYD---------- 159
            |  |.||::..|:|:..::   .|:::.:..:.|:        ..|.|..|.:..          
  Fly    78 E--SRWRYFKQMQFLVDSIRQYRESLLGKCANGSQ--------SANQVADPSQQQQAQQQTVVDI 132

  Fly   160 -SMPI--VATEPICELSHSY------DSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREED 215
             :.|.  .||.....|:|.:      |::|......|...:|.:     |..||      :|.|:
  Fly   133 FAQPFNGSATTSAQALTHPHEITVTSDAQLATAVGKDQKPYFYE-----PPLKR------ERSEE 186

  Fly   216 EEDDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSE 280
            |..|:..:.....:|      |.:.|.|:         :|......||...  ||    ..::.:
  Fly   187 EHSDNMLNTIKIFQN------NVSQAVSA---------EDQSFGMVVTDML--NT----LGVRQK 230

  Fly   281 QEAKV 285
            .||||
  Fly   231 AEAKV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 22/80 (28%)
BESS 320..353 CDD:281011
Adf1NP_001260730.1 MADF 15..95 CDD:214738 22/83 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D98646at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.