DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and CG11504

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_651758.1 Gene:CG11504 / 43557 FlyBaseID:FBgn0039733 Length:410 Species:Drosophila melanogaster


Alignment Length:263 Identity:54/263 - (20%)
Similarity:84/263 - (31%) Gaps:54/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDV--NLPADICRIKWGHLRDNFRKVY 100
            |...:||:....|..||.......:|:.....:..||.|.:  |:|.:....|:..||..:.:..
  Fly     6 EKTLQLISEYRSRRGLWDMTCDEYRKKDVKQRLLNEVSQVLGGNIPINELEKKFHTLRTQYHREI 70

  Fly   101 IRNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVA 165
            .|........|.|..:.::.|:....   ..|.|:...|....|  .|...|||           
  Fly    71 SRMKRKEPYNSKWFGFKNLVFLSSPY---ACRSTKGRLKADLQG--DERKFVLG----------- 119

  Fly   166 TEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDAASEN 230
                 |::..::|                 |...|.|....:..:..||....:.........|.
  Fly   120 -----EVTADHNS-----------------DSSTPANHNSNTNANMNEEYLRKNHASSRAQELEK 162

  Fly   231 LEEERGNRADAASSGVFTIEVLD-DDDEMEQAVTKTK-ANNTSHGGSSLKSEQEAKVFSNSQSPT 293
            |.||.            |.:|.| |:.|:|:...|.| |...|....||..::|.:...|.....
  Fly   163 LIEET------------TKDVDDIDESELEEGEVKPKQAKEMSVRFVSLNEQEETEPLENHHQTL 215

  Fly   294 ADL 296
            .||
  Fly   216 MDL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 18/83 (22%)
BESS 320..353 CDD:281011
CG11504NP_651758.1 MADF_DNA_bdg 11..92 CDD:287510 17/80 (21%)
CytochromB561_N 238..>409 CDD:286826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.