DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and hng1

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:341 Identity:68/341 - (19%)
Similarity:119/341 - (34%) Gaps:91/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNN 104
            ||..:...|.|:   |.:....|::.:   .|.:|...:|:.....|.:|..|||.:.:...:..
  Fly    15 LIQTIRETPSLYDPQLPSFRLSQRKEE---DWAKVADLLNISISDARRRWTCLRDRYSRELKQKR 76

  Fly   105 LSNETPSSWRFYND----MRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVA 165
            |.   ||....:||    |.|:...|.:...|:.|...::..|..|.:.:  |...:...:|| .
  Fly    77 LH---PSGEFGHNDFFRKMDFLRDFVRKRRERRGRERDREQKPTGWMKVD--LQRRRRTRLPI-D 135

  Fly   166 TEPICEL--SHSYDS-----------ELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE 217
            ||.:.|.  ||:||.           |.|.......|...|..|.|.||.:.|            
  Fly   136 TETLIEEQGSHAYDEGEEQHDYDAKLESHTTQSETYSVVVEADDGQEPEQESF------------ 188

  Fly   218 DDDDFDEDAASENLEEERGNRADAASSGVFTIEVLDDDDEM--EQAVTKTKANNTSHG------- 273
              |:|..||..|.                 .::|:....|:  ..|.:..:...::|.       
  Fly   189 --DEFLGDAECEQ-----------------KVKVVTIHPEIAAPNATSAPEPIESNHADLNYLVC 234

  Fly   274 ---GSSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRL 335
               .::.:.|..|....|   |||.:..|...|:                |..|..|:..:|::|
  Fly   235 MPPNANQEREHSAPELPN---PTAVITQKTCETE----------------DDFFCKSIAAYLRQL 280

  Fly   336 DSRRRLRVRQKLQNVL 351
            ....:::.:.::..:|
  Fly   281 SRVHKIKAKVEMYQIL 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 21/87 (24%)
BESS 320..353 CDD:281011 6/32 (19%)
hng1NP_611558.2 MADF 15..98 CDD:214738 21/88 (24%)
BESS 264..298 CDD:281011 7/49 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.