DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and CG7745

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:326 Identity:65/326 - (19%)
Similarity:114/326 - (34%) Gaps:70/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLSNETP- 110
            :..|...:|...|||.|.......|..:...:....|.|:.:|.:||:.    |:......:.| 
  Fly    16 IYNRQKYYLNGGANGGKYETKDEAWQLIAMKLRTDVDTCKKRWKYLRER----YVSQRKQGDPPV 76

  Fly   111 ---SSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWT--ENNNVLGPDKYD------SMPIV 164
               .|..:...|:|::..:      |.| .|.:|.|...|  ::.|..|.::|.      ||..|
  Fly    77 YEHLSRPYLEKMKFLDQHI------QPR-KSYRHVPNFLTSPQSANSSGYNEYQVDKSNGSMKNV 134

  Fly   165 ATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPE--NKRFKSEPSQREEDEEDDDDFDEDAA 227
            :.......||.|    |||......|...:......|  |.:.|.|..|...      ||....|
  Fly   135 SQFGSSGQSHLY----HQPDQQHAMSALSNVAASALENVNGQVKIEADQVFR------DFAAAVA 189

  Fly   228 SENLEEERGNRADAASSGVFTIEVLD-----DDDEMEQAVTKTKANNTSHG----GSSLKS---- 279
            |:.|:....::....::.|..: :.|     .|...:.:|....|.|::..    .||:||    
  Fly   190 SQQLQHISQSQMQQQAAAVAAV-MADSSQGYQDQYKDGSVGMNGAQNSAGSLTSTSSSMKSPLSS 253

  Fly   280 -------------------EQEAKVFSNSQSPTAD--LPFKYISTDVATNTDPSGGDLQDEADRM 323
                               :|:.:..:..|||.::  ||..:.|:.....:..:...||.:...:
  Fly   254 PLQGIGAGSHHPQQQTQQQQQQQQQQAQQQSPASEQQLPVVHSSSSATGASIGNSSTLQMQQSHV 318

  Fly   324 F 324
            :
  Fly   319 Y 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 17/80 (21%)
BESS 320..353 CDD:281011 0/5 (0%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.