DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and CG11723

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001259906.1 Gene:CG11723 / 33388 FlyBaseID:FBgn0031391 Length:350 Species:Drosophila melanogaster


Alignment Length:320 Identity:72/320 - (22%)
Similarity:124/320 - (38%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFRKVYIRNNLS 106
            |||..||:|..||..|.:...:..|....|..|.|.:.....||:.::..:||::|....:....
  Fly     7 RLIQEVSKRRCLWDTNMSISYRNQDAALQWASVAQIMQQDVSICKKRFKGMRDSYRAEVRKIQQK 71

  Fly   107 NETPSSWRFYNDMRFM----EPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVATE 167
            ....|.|.::..:.||    :|   |.::        ..||..:..|..  .|:.:        |
  Fly    72 RIEMSHWPYFRSLEFMRQIFDP---EGLV--------PFPPEPFVMNTE--QPEVF--------E 115

  Fly   168 PICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDE--DAASEN 230
            |...:..:.|.:|......|. ...||         .||.|||..::...|.....:  |::|..
  Fly   116 PTRLVDFAIDLDLDNDDSVDF-EIIED---------IFKREPSVPQDSGSDKGSLIKPLDSSSSG 170

  Fly   231 LEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSEQEAKVFSNSQSPTAD 295
                 .:|:|...|....|.:......:.:....:|.      |...|:           ||:.|
  Fly   171 -----AHRSDQDLSPTLPIHLPRHQQFLPRPPPPSKR------GRRRKT-----------SPSND 213

  Fly   296 LPF--KYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIE 353
            :|.  .|.|....:.|:|   ||::::|..||:|:||.::.|.:...|:.|.::..||:|
  Fly   214 VPLLNGYASQASKSTTEP---DLKNDSDLSFLMSMMPHVKSLSAISNLKFRMEMARVLVE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 22/85 (26%)
BESS 320..353 CDD:281011 11/32 (34%)
CG11723NP_001259906.1 MADF 7..91 CDD:214738 22/83 (27%)
BESS 236..270 CDD:281011 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.