DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and CG8119

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_573050.1 Gene:CG8119 / 32500 FlyBaseID:FBgn0030664 Length:244 Species:Drosophila melanogaster


Alignment Length:343 Identity:67/343 - (19%)
Similarity:104/343 - (30%) Gaps:143/343 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IETVKRLIAAVSRRPMLWLRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNFR-KVY 100
            :|| ..|:..::.||.:|........:|..|...|.:|...|.|..|.|:.:|..||:|:| |::
  Fly    13 LET-NHLLREIALRPSIWDSRIKFSLRRPQIPIDWLDVSNAVGLGVDECKRRWKSLRNNYRTKIH 76

  Fly   101 IRNNLSNETPSSWRFYNDMRFME---PAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMP 162
            ..|      ..||.....|.|:.   |........:.|...||        :..:|.|.:|    
  Fly    77 QGN------AWSWPHSKQMEFVRDVFPPHKPKTPARCRVQVKK--------SKLILHPQQY---- 123

  Fly   163 IVATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEE-----DDDDF 222
                                  ...::|:           ..||....:.|.:|.     |:..|
  Fly   124 ----------------------LQSVASY-----------SAFKKGGIEFEAEERLFLVTDEPAF 155

  Fly   223 DEDAASENLEEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSEQEAKVFS 287
            |                            ||.|:|:.                            
  Fly   156 D----------------------------LDVDEEVT---------------------------- 164

  Fly   288 NSQSPTADLPFKYISTDV---ATNTD-----------PSG-GDLQDEADRMFLLSLMPFLQRLDS 337
                       :.:.||.   .||.|           ||. ..:.:|::|.||||::|.|:.|..
  Fly   165 -----------RLLGTDQWLWQTNLDFILLPIFRAPPPSAMAKISNESNRHFLLSMVPMLRSLSD 218

  Fly   338 RRRLRVRQKLQNVLIEEL 355
            |.:.|.|...:.||.|.|
  Fly   219 RSKERFRSWTRRVLREML 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 23/85 (27%)
BESS 320..353 CDD:281011 13/32 (41%)
CG8119NP_573050.1 MADF 17..97 CDD:214738 23/85 (27%)
BESS 201..234 CDD:281011 13/32 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103389at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12243
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.