DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:149 Identity:30/149 - (20%)
Similarity:54/149 - (36%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 WFEVGQDVNLP-ADICRIKWGHLRDNFRKVYIR--NNLSNETPSSWRFYNDMRFMEPAVH----- 127
            |.|:...:.:. .:.|:..|.::||.|.|...|  ....:|.....|.:.:::::.|.|.     
Zfish    36 WKEIATKLGIDNPETCKSTWRNIRDKFSKAMKRMLRKGGDEDARVPRLFVELKWLRPFVRLRANT 100

  Fly   128 -----------------ENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVATEPICELS-- 173
                             :|::.:..|||     ...|..::|.|.....|:....|..:..||  
Zfish   101 VSDTPCFEFEIQNEETPKNMVAEESSSS-----SGCTNESDVEGRCSAASLDAFGTSALHRLSST 160

  Fly   174 --HSYDSELHQPSFSDISS 190
              .:..|.:.|||.|...|
Zfish   161 PCEAVTSTIAQPSPSSAPS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 11/55 (20%)
BESS 320..353 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.