DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and si:zfos-128g4.1

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_002661969.1 Gene:si:zfos-128g4.1 / 100334256 ZFINID:ZDB-GENE-141212-382 Length:248 Species:Danio rerio


Alignment Length:337 Identity:56/337 - (16%)
Similarity:107/337 - (31%) Gaps:129/337 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KRLIAAVSRRPMLW---LRNNANGQKRSDITPVWFEVGQDVNLPADICRIKWGHLRDNF----RK 98
            ::||..|...|:|:   |.:..:.::|   ...|.||...|.|....|:.:|..:||.:    |.
Zfish     7 EKLIQTVYAFPVLYNVSLHDYRSTERR---VKAWREVAASVGLSVVECKRRWKTIRDRYIRERRL 68

  Fly    99 VYIRNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPI 163
            ..::.:|.......|.....:.|::..:.:          ::.|.|                   
Zfish    69 CKLKKDLGGRRLHYWPHRESLAFLDAHIRK----------RRRPSG------------------- 104

  Fly   164 VATEPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDAAS 228
                                             .|.||.:       |:||........|::..|
Zfish   105 ---------------------------------AQGPEEE-------QQEEHSSAALQEDKECVS 129

  Fly   229 ENLEEERGNRADAASSGVFTIEVLDDDDEMEQA-------------------VTKTKANNTSHGG 274
            |...:. |:|. |.|....:|.......:::..                   |..:...:.|.|.
Zfish   130 EECVDS-GSRL-AVSPLPVSIMSAPPPPQLKAVPQVSPLLLAALPPGLKVAPVCSSATGSASAGP 192

  Fly   275 SSLKSEQEAKVFSNSQSPTADLPFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRLDSRR 339
            .::..|::.:         ||                  |.|.:  |::||||.:|.|:||..::
Zfish   193 LNVPLEEQQR---------AD------------------GALDE--DQLFLLSYVPALKRLTPQK 228

  Fly   340 RLRVRQKLQNVL 351
            |..|:.::|.::
Zfish   229 RAAVKMQIQQIM 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 20/88 (23%)
BESS 320..353 CDD:281011 12/32 (38%)
si:zfos-128g4.1XP_002661969.1 MADF 8..97 CDD:214738 20/91 (22%)
BESS 208..242 CDD:281011 12/35 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.