DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coop and LOC100330838

DIOPT Version :9

Sequence 1:NP_001260776.1 Gene:Coop / 35677 FlyBaseID:FBgn0263240 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001373242.1 Gene:LOC100330838 / 100330838 -ID:- Length:204 Species:Danio rerio


Alignment Length:317 Identity:69/317 - (21%)
Similarity:106/317 - (33%) Gaps:127/317 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KRLIAAVSRRPMLWLRNNANGQK-RSDITPVWFEVGQDVNLPADICRIKWGHLRDNF---RKVYI 101
            :|||||||..|.|: .:..|..| .:.....|..|...|.:|.:.||.:|..|||.|   ::...
Zfish     7 ERLIAAVSDYPELY-NSTINSYKDAARKAKAWRAVSLQVEIPEEDCRRRWKSLRDMFIKDKRAEQ 70

  Fly   102 RNNLSNETPSSWRFYNDMRFMEPAVHENIMRQTRSSSKKHPPGHWTENNNVLGPDKYDSMPIVAT 166
            |...|..:..||::...|.|:.|.:      |:||                          :.|.
Zfish    71 RRRASGTSHRSWKYSWQMSFLTPFI------QSRS--------------------------LAAD 103

  Fly   167 EPICELSHSYDSELHQPSFSDISSFFEDRDCQPPENKRFKSEPSQREEDEEDDDDFDEDAASENL 231
            ||                                             |::.||:|.||:..::  
Zfish   104 EP---------------------------------------------EEDRDDEDKDEERTAD-- 121

  Fly   232 EEERGNRADAASSGVFTIEVLDDDDEMEQAVTKTKANNTSHGGSSLKSEQEAKVFSNSQSPTADL 296
                ||.|       |.::..:.|..|....:...|:.:...|...|...||             
Zfish   122 ----GNSA-------FVVQDFEGDHGMLDGASHYSASGSQGSGRKRKWHMEA------------- 162

  Fly   297 PFKYISTDVATNTDPSGGDLQDEADRMFLLSLMPFLQRLDSRRRLRVRQKLQNVLIE 353
                            ..||:||   |||.||:|:|:||...::..|:.|:..:|.|
Zfish   163 ----------------NEDLEDE---MFLFSLLPYLRRLPYAKKSAVKLKIHQLLYE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CoopNP_001260776.1 MADF 42..124 CDD:214738 28/85 (33%)
BESS 320..353 CDD:281011 12/32 (38%)
LOC100330838NP_001373242.1 MADF 8..96 CDD:214738 29/94 (31%)
BESS 167..200 CDD:397204 14/35 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.