Sequence 1: | NP_610284.1 | Gene: | p47 / 35674 | FlyBaseID: | FBgn0033179 | Length: | 407 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001376485.1 | Gene: | UBXN11 / 91544 | HGNCID: | 30600 | Length: | 520 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 62/260 - (23%) |
---|---|---|---|
Similarity: | 97/260 - (37%) | Gaps: | 76/260 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 TIENKPVVVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQELLEM-------------- 258
Fly 259 --------------GRMVN-------VD-VEDH-----RHEDFK----------------RQPVP 280
Fly 281 QTFKGSGQKLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAPS-TTLQIRLADGSR 344
Fly 345 -LAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGL-KNAALMQRLK 407
Fly 408 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
p47 | NP_610284.1 | UBA_ceTYDP2_like | 6..42 | CDD:270612 | |
SEP | 211..300 | CDD:197786 | 27/145 (19%) | ||
p47_UBX | 329..407 | CDD:176365 | 25/80 (31%) | ||
UBXN11 | NP_001376485.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
bchH | <119..>256 | CDD:237377 | 9/29 (31%) | ||
SEP | 235..306 | CDD:400413 | 12/70 (17%) | ||
UBX_UBXN11 | 395..464 | CDD:340597 | 19/69 (28%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 476..520 | ||||
3 X 8 AA tandem repeats of P-G-P-G-P-G-P-S | 487..510 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2086 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |