DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and UBXN11

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001376485.1 Gene:UBXN11 / 91544 HGNCID:30600 Length:520 Species:Homo sapiens


Alignment Length:260 Identity:62/260 - (23%)
Similarity:97/260 - (37%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TIENKPVVVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQELLEM-------------- 258
            |:|..|   |||:..|..:..|..:.:.||..:..|..::.|..|.||..:              
Human   229 TLEPIP---LKLYRNGIMMFDGPFQPFYDPSTQRCLRDILDGFFPSELQRLYPNGVPFKVSDLRN 290

  Fly   259 --------------GRMVN-------VD-VEDH-----RHEDFK----------------RQPVP 280
                          ||:|.       :| ||:|     ..|.|.                |.|:.
Human   291 QVYLEDGLDPFPGEGRVVGRQLMHKALDRVEEHPGSRMTAEKFLNRLPKFVIRQGEVIDIRGPIR 355

  Fly   281 QTFKGSGQKLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAPS-TTLQIRLADGSR 344
            .|.:.. ..|.:.:..:|.|.||:        ||.:|.|....   |:.||. :.|:|:..:|.:
Human   356 DTLQNC-CPLPARIQEIVVETPTL--------AAERERSQESP---NTPAPPLSMLRIKSENGEQ 408

  Fly   345 -LAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGL-KNAALMQRLK 407
             ........:|:.|:|..:..||.. ..|.|.:.|:||.....||..|::.||| ..|||:.|.:
Human   409 AFLLMMQPDNTIGDVRALLAQARVM-DASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRAR 472

  Fly   408  407
            Human   473  472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 27/145 (19%)
p47_UBX 329..407 CDD:176365 25/80 (31%)
UBXN11NP_001376485.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
bchH <119..>256 CDD:237377 9/29 (31%)
SEP 235..306 CDD:400413 12/70 (17%)
UBX_UBXN11 395..464 CDD:340597 19/69 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..520
3 X 8 AA tandem repeats of P-G-P-G-P-G-P-S 487..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.