DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and PUX3

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_193946.3 Gene:PUX3 / 828304 AraportID:AT4G22150 Length:302 Species:Arabidopsis thaliana


Alignment Length:310 Identity:94/310 - (30%)
Similarity:161/310 - (51%) Gaps:42/310 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 TLSDMSKESSSDDDQ-----QAFYAGGSDRSGQQVLGPPKRKNFREQLTDMMRSAQEQNIAEVGP 168
            ||||:::.|..|.|.     |.::.|| ::||..|..|.|... .:.:.::...|::....| ||
plant    21 TLSDLNRRSEPDSDSDSDGPQEYFTGG-EKSGMLVQDPTKEPK-HDDVDEIFNQARQLGAVE-GP 82

  Fly   169 --STSSGSASGGSGGAVWGQGMRLGMTDNDHTAVGTKKPAATIENKPVV-VLKLWSQGFSIDGGE 230
              ..||..:..|:|..:.|:.:                |.|..:.:||: .:..||.||::|.|.
plant    83 LEHPSSSRSFTGTGRLLSGESV----------------PTALQQPEPVIHNIIFWSNGFTVDDGP 131

  Fly   231 LRHYDDPQNKEFLETVMRGEIPQELLEMGRMVNVDVEDHRHEDF--KRQPVPQTFKGSGQKLG-- 291
            ||..|||:|..||:::.:.|.|:||..:.:...|.|...|.::.  :::.:..:|:|.|:.||  
plant   132 LRKLDDPENASFLDSIRKSECPKELEPVDKRAPVHVNLMRRDEKCPEKEKLKVSFQGVGRTLGGA 196

  Fly   292 -SPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAPSTTLQIRLADGSRLAAQFNLSHTV 355
             |..|:..:....|....||          ..::.::...|||::|:|||||:|:.|:||..|||
plant   197 SSSTASSQSNLTDVAAVQSP----------LQSLVVDETLPSTSIQLRLADGTRMVAKFNNHHTV 251

  Fly   356 SDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGLKNAALMQR 405
            :|||.||:.:||....:..:.|..||.:.|:|.:.|||:|||.::.::|:
plant   252 NDIRGFIEFSRPGNPNNYTLQVMGFPPKPLTDPSQTIEQAGLASSVVIQK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 30/94 (32%)
p47_UBX 329..407 CDD:176365 35/77 (45%)
PUX3NP_193946.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3144
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41114
Inparanoid 1 1.050 159 1.000 Inparanoid score I1647
OMA 1 1.010 - - QHG54012
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - mtm1199
orthoMCL 1 0.900 - - OOG6_102041
Panther 1 1.100 - - O PTHR23333
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X629
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.