DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and Ubxn2b

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_080810.2 Gene:Ubxn2b / 68053 MGIID:1915303 Length:331 Species:Mus musculus


Alignment Length:338 Identity:120/338 - (35%)
Similarity:177/338 - (52%) Gaps:56/338 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PAATKAKPKFATL-SDMSKESSSDDDQQA-------------FYAGGSDRSGQQVLGPPKRKNFR 148
            |:|...:...|.| .|..|..||..|:..             .|:|.....|..::.||..|...
Mouse    22 PSARDLQLALAELYEDEMKCKSSKPDRSTPATCRSPRTPPHRLYSGDHKYDGLHIVQPPTGKIVN 86

  Fly   149 EQLTDMMRSAQEQNIAEVGPSTSSG------SASGGSGGAVWGQGMRLGMTDNDHTAVGTKKPAA 207
            |    :.:.|:|.....:..:|.|.      |.:||        |.|||.:        ..|.:.
Mouse    87 E----LFKEAREHGAVPLNEATRSSREDKTKSFTGG--------GYRLGNS--------FYKRSE 131

  Fly   208 TI--ENK---PVVVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQEL--LEMGRMVNVD 265
            .|  ||:   ..|:||||..|||:|.||||.|.||.|.:|||:|.|||.|.||  |..|..||:|
Mouse   132 YIYGENQLQDVQVLLKLWRNGFSLDDGELRPYSDPTNAQFLESVKRGETPLELQRLVHGAQVNLD 196

  Fly   266 VEDHRHEDFKRQPVP-QTFKGSGQKLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSE 329
            :|||:.:::.:..:. :.|.|.||||||    |..|..:.|  .||.|......:|  |:.::..
Mouse   197 MEDHQDQEYIKPRLRFKAFSGEGQKLGS----LTPEIVSTP--SSPEEEDKSILNA--AVLIDDS 253

  Fly   330 APSTTLQIRLADGSRLAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEK 394
            .|:|.:||||||||||..:||.:|.:.|:|.||..:||:::|::||||:|||::||:|:..|:::
Mouse   254 MPTTKIQIRLADGSRLVQRFNSTHRILDVRDFIVRSRPEFATTDFILVTSFPSKELTDETVTLQE 318

  Fly   395 AGLKNAALMQRLK 407
            |.:.|..::|:||
Mouse   319 ADILNTVILQQLK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 45/94 (48%)
p47_UBX 329..407 CDD:176365 36/77 (47%)
Ubxn2bNP_080810.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 11/47 (23%)
SEP 140..232 CDD:197786 45/95 (47%)
p47_UBX 255..331 CDD:176365 36/75 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833360
Domainoid 1 1.000 87 1.000 Domainoid score I7988
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - otm42463
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X629
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.