DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and prom

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001137754.1 Gene:prom / 246493 FlyBaseID:FBgn0259210 Length:1235 Species:Drosophila melanogaster


Alignment Length:340 Identity:65/340 - (19%)
Similarity:116/340 - (34%) Gaps:114/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KPKPTSSSGASASASAAGATKSADSAVATSSASVDIAPAATKAKPKFATLSDMSKESSSDDDQQA 125
            |.:.||||..|..:.....::..    :|||.:....|....|..:...|:|.....|....||.
  Fly   877 KKQRTSSSATSGRSGKRDQSRER----STSSTARPKPPLRRTATEETLDLADEESTPSRQQQQQP 937

  Fly   126 FYAGGSDRSGQQVLGPPKRK--NFREQLTDMMRSAQEQNIAEVGPSTSS---------------- 172
                           ||:|:  :.||::.:..:.::|:.::. |...|:                
  Fly   938 ---------------PPQRRQESDRERVRERDQRSRERELSR-GRDASAMNTPVRSRSRQQLRHD 986

  Fly   173 ------GSASGGSGGAVWGQGMRLGMTDNDHTAVGTKKPAATIENKPVVVLKLWSQGFSIDGGEL 231
                  ||:||.|         |....:.|..:..|:|           :|.:|           
  Fly   987 PEDDNWGSSSGPS---------RANSRERDRESSQTRK-----------ILNIW----------- 1020

  Fly   232 RHYDDPQNKEFLETVMRGEIPQELLEMGRMVNVDVEDHRHED-----FKRQPVPQTFKGSGQKLG 291
                  |::...:|.:|.:..:|.         |.|| .|:|     ..:..|....:...|...
  Fly  1021 ------QSRNKAKTPLRRQGTEEF---------DFED-AHDDRGWQAQTQNQVQNQSRAHNQSSV 1069

  Fly   292 SPV---------ANLVTEAPTVPVALSPGEAANQEASAR---DAINLNSEAPSTTLQIRLADGSR 344
            ||.         :||.|:.   .:..:..:.|:.||..|   ..:::||:.|:.....|..  .|
  Fly  1070 SPEQRPDPRSHRSNLRTKP---KLRSTNADRASSEAIRRPITPVLSVNSDIPAAIPMPRTP--MR 1129

  Fly   345 LAAQFNL-SHTVSDI 358
            |.::.:| :..|.||
  Fly  1130 LKSKVSLTARAVQDI 1144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 17/102 (17%)
p47_UBX 329..407 CDD:176365 8/31 (26%)
promNP_001137754.1 Prominin 73..826 CDD:283200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.