DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and Ubxn11

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_038965170.1 Gene:Ubxn11 / 192207 RGDID:620769 Length:533 Species:Rattus norvegicus


Alignment Length:252 Identity:58/252 - (23%)
Similarity:93/252 - (36%) Gaps:60/252 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 TIENKPVVVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQELLEMGRMVNVDVEDHRHE 272
            |:|..|   |||:..|..:..|..|.:.||..:..|..::.|..|.||    :.:..|....:..
  Rat   271 TLEPIP---LKLYRNGIMMFDGPFRPFYDPYTQRCLRDILDGFFPSEL----QRLYPDGVPFKVS 328

  Fly   273 DFKRQPVPQ----TFKGSGQKLGSPVANLVTE---------------APTVP-VALSPGEAANQE 317
            |.:.|..|:    .|.|.|:.:|......||:               ...:| ..:..||..:..
  Rat   329 DLRNQVYPEDGLGPFPGEGRVVGRQKIRKVTDRVEETSGSRMTAEKFLNRLPKCVIRQGEVIDIR 393

  Fly   318 ASARDAIN------------------LNSE------------APSTTLQIRLADGSR-LAAQFNL 351
            ...||.:.                  |.||            .|.:.|:|:..:|.: .......
  Rat   394 GPIRDTLQNCCPMPVRIQEIIVETPALASERQRTQESPNMPVPPLSMLRIKSENGEQAFLLMMRP 458

  Fly   352 SHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGL-KNAALMQRLK 407
            ..|:.|:|..:..||...|.: |.::|:||.....||..|::.||| .||.|:.|.:
  Rat   459 EDTIGDVRNLLAQARDMDSAA-FEILSTFPPTVYRDDTVTLQAAGLVPNATLLLRTR 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 23/92 (25%)
p47_UBX 329..407 CDD:176365 25/91 (27%)
Ubxn11XP_038965170.1 SEP 277..348 CDD:400413 19/74 (26%)
UBX_UBXN11 437..512 CDD:340597 23/75 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.