DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and ubxn-2

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001023590.1 Gene:ubxn-2 / 177057 WormBaseID:WBGene00022381 Length:301 Species:Caenorhabditis elegans


Alignment Length:316 Identity:90/316 - (28%)
Similarity:137/316 - (43%) Gaps:63/316 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SKESSSDDDQ----QAFYAGGSDRSGQQVLGPPKRKNFREQLTDMMRSA------QEQNIAEVGP 168
            |.:|.:|..:    |.||||    |||.|.||              |.|      .|.:|..:..
 Worm    21 SDDSGADAAERGAPQEFYAG----SGQAVQGP--------------RGAAARGPDSEAHIRRILQ 67

  Fly   169 STSSGSASGGSGGAVWGQGMRLGMTDNDHTAVGTKKPAATIENKPVVVLKLWSQGFSIDGGELRH 233
            :.......||....                  |......||.    :.|.|||.|.||:.|.|..
 Worm    68 AAEVVQPEGGEAPR------------------GRPSGRETIS----LTLHLWSDGLSIEDGPLMS 110

  Fly   234 YDDPQNKEFLETVMRGEIPQELLEMGRMVNVDVEDHRHEDFKRQPVPQTFKGSGQKLGSPVANLV 298
            ..||:..||||:|.:||||..|::......:|.:.:||.:....|..:.|.|||.:||:.|..::
 Worm   111 RQDPRTIEFLESVGKGEIPPSLVQQYPGKEIDFKVNRHHEEYVAPKMKPFGGSGVRLGNVVPTVL 175

  Fly   299 -------TEAPTVPVAL--SPGEAANQEA----SARDAINLNSEAPSTTLQIRLADGSRLAAQFN 350
                   |.|.|.....  :|...|..||    .|:..::.|...|:|.:||||.:..||...||
 Worm   176 GQSSSSATTAGTSSATTDHNPDHTAENEAKQLEDAKKELSTNMNEPTTNIQIRLPNNQRLVGIFN 240

  Fly   351 LSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGLKNAALMQRL 406
            .|||:..:|.||.||||....:.|.:::::|.:...|::.|::.|.:.|:.:..::
 Worm   241 HSHTLEAVRTFICTARPDMIYAPFQMMAAYPPKPFEDESQTLKDANVLNSVVAVKI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 32/95 (34%)
p47_UBX 329..407 CDD:176365 26/78 (33%)
ubxn-2NP_001023590.1 SEP 94..164 CDD:311829 27/69 (39%)
UBQ 220..292 CDD:320785 26/71 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7158
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3880
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - otm14349
orthoMCL 1 0.900 - - OOG6_102041
Panther 1 1.100 - - LDO PTHR23333
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X629
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.