DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and UBXN2A

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_859064.2 Gene:UBXN2A / 165324 HGNCID:27265 Length:259 Species:Homo sapiens


Alignment Length:271 Identity:78/271 - (28%)
Similarity:132/271 - (48%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DMMRSAQEQNIAEVGPSTSSGSASGGSGGAVWGQGMRLGMTDNDH------------TAVGTKKP 205
            |.::|.:|:.:.|.|                 .....||.....:            ..|.:|..
Human     5 DNLKSIKEEWVCETG-----------------SDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCV 52

  Fly   206 AATIENKPV-VVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQELLEM--GRMVNVDVE 267
            :...:.|.| |.:|||..||::: .:.|.|.|..:::||.::.:||:|.||..:  ...|:|.||
Human    53 SPAEQKKQVDVNIKLWKNGFTVN-DDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVE 116

  Fly   268 DHRHE-DFKRQPVPQTFKGSGQKLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAP 331
            |.::| ....:||.|.|.|.|.:|||....:|::|..:.|         :..:...|:.||:..|
Human   117 DKKNEICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEV---------ENKNNLSAVPLNNLEP 172

  Fly   332 STTLQIRLADGSRLAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAG 396
            .|.:||.||:|.|:..:||::|.||.|:.||:..:....:..|.|.::.|...|.|:..|:|:|.
Human   173 ITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEAD 237

  Fly   397 LKNAALMQRLK 407
            |:||.::|||:
Human   238 LQNAVIIQRLQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 34/92 (37%)
p47_UBX 329..407 CDD:176365 29/77 (38%)
UBXN2ANP_859064.2 SEP 65..138 CDD:311829 26/73 (36%)
p47_UBX 170..248 CDD:176365 29/77 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23333
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1594
SonicParanoid 1 1.000 - - X629
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.