DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and UBXN2A

DIOPT Version :10

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_859064.2 Gene:UBXN2A / 165324 HGNCID:27265 Length:259 Species:Homo sapiens


Alignment Length:271 Identity:78/271 - (28%)
Similarity:132/271 - (48%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DMMRSAQEQNIAEVGPSTSSGSASGGSGGAVWGQGMRLGMTDNDH------------TAVGTKKP 205
            |.::|.:|:.:.|.|                 .....||.....:            ..|.:|..
Human     5 DNLKSIKEEWVCETG-----------------SDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCV 52

  Fly   206 AATIENKPV-VVLKLWSQGFSIDGGELRHYDDPQNKEFLETVMRGEIPQELLEM--GRMVNVDVE 267
            :...:.|.| |.:|||..||::: .:.|.|.|..:::||.::.:||:|.||..:  ...|:|.||
Human    53 SPAEQKKQVDVNIKLWKNGFTVN-DDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVE 116

  Fly   268 DHRHE-DFKRQPVPQTFKGSGQKLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAP 331
            |.::| ....:||.|.|.|.|.:|||....:|::|..:.|         :..:...|:.||:..|
Human   117 DKKNEICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEV---------ENKNNLSAVPLNNLEP 172

  Fly   332 STTLQIRLADGSRLAAQFNLSHTVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAG 396
            .|.:||.||:|.|:..:||::|.||.|:.||:..:....:..|.|.::.|...|.|:..|:|:|.
Human   173 ITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEAD 237

  Fly   397 LKNAALMQRLK 407
            |:||.::|||:
Human   238 LQNAVIIQRLQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 34/92 (37%)
UBX_UBXN2 334..405 CDD:340468 25/70 (36%)
UBXN2ANP_859064.2 Required for inhibition of CHRNA3 ubiquitination and translocation of CHRNA3 to the plasma membrane resulting in an increase in acetylcholine-gated nicotinic acetylcholine receptor currents. /evidence=ECO:0000250|UniProtKB:Q99KJ0 1..164 45/185 (24%)
Required for interaction with CHRNA3. /evidence=ECO:0000269|PubMed:26265139 1..151 43/163 (26%)
SEP 65..138 CDD:462348 26/73 (36%)
Required for interaction with VCP. /evidence=ECO:0000269|PubMed:26265139 167..259 32/82 (39%)
UBX_UBXN2A 167..250 CDD:340680 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.