DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and UBXN2B

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001071087.1 Gene:UBXN2B / 137886 HGNCID:27035 Length:331 Species:Homo sapiens


Alignment Length:367 Identity:124/367 - (33%)
Similarity:184/367 - (50%) Gaps:53/367 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GHADNPKPKPTSSSG----ASASASAAGATKSADSAVATSSASVDIAPAATKAKPKFATLSDMSK 115
            |....|..:...|||    ::.....|.|....|.....||.|  ..|.||..|           
Human     4 GGGPEPGEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKS--NRPKATVFK----------- 55

  Fly   116 ESSSDDDQQAFYAGGSDRSGQQVLGPPKRKNFREQLTDMMRSAQEQNIAEVGPSTSSGSASG-GS 179
              |.....|.||:...:.||..::.|...|...|    :.:.|:|.....:..:|   .||| ..
Human    56 --SPRTPPQRFYSSEHEYSGLNIVRPSTGKIVNE----LFKEAREHGAVPLNEAT---RASGDDK 111

  Fly   180 GGAVWGQGMRLGMT--DNDHTAVGTKKPAATIENK---PVVVLKLWSQGFSIDGGELRHYDDPQN 239
            ..:..|.|.|||.:  .......|        ||:   ..::|||||.|||:|.||||.|::|.|
Human   112 SKSFTGGGYRLGSSFCKRSEYIYG--------ENQLQDVQILLKLWSNGFSLDDGELRPYNEPTN 168

  Fly   240 KEFLETVMRGEIPQEL--LEMGRMVNVDVEDHRHEDFKRQPVP-QTFKGSGQKLGSPVANLVTEA 301
            .:|||:|.|||||.||  |..|..||:|:|||:.:::.:..:. :.|.|.||||||....:|:  
Human   169 AQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQDQEYIKPRLRFKAFSGEGQKLGSLTPEIVS-- 231

  Fly   302 PTVPVALSPGEAANQEASARDAINL-NSEAPSTTLQIRLADGSRLAAQFNLSHTVSDIRRFIQTA 365
                   :|.....::.|..:|:.| :...|:|.:||||||||||..:||.:|.:.|:|.||..:
Human   232 -------TPSSPEEEDKSILNAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRILDVRNFIVQS 289

  Fly   366 RPQYSTSNFILVSSFPTRELSDDNSTIEKAGLKNAALMQRLK 407
            ||:::..:||||:|||.:||:|::.|:.:|.:.|..|:|:||
Human   290 RPEFAALDFILVTSFPNKELTDESLTLLEADILNTVLLQQLK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 45/94 (48%)
p47_UBX 329..407 CDD:176365 36/77 (47%)
UBXN2BNP_001071087.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..65 9/39 (23%)
SEP 140..232 CDD:197786 44/100 (44%)
p47_UBX 253..331 CDD:176365 36/77 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143199
Domainoid 1 1.000 86 1.000 Domainoid score I8091
eggNOG 1 0.900 - - E1_KOG2086
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3194
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - otm40391
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X629
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.