DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p47 and ubxn2b

DIOPT Version :9

Sequence 1:NP_610284.1 Gene:p47 / 35674 FlyBaseID:FBgn0033179 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_004915243.2 Gene:ubxn2b / 101733824 XenbaseID:XB-GENE-13579709 Length:351 Species:Xenopus tropicalis


Alignment Length:379 Identity:113/379 - (29%)
Similarity:187/379 - (49%) Gaps:68/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DNPKPKPTSSSGASASASAAGATKSADSAVATSSASVDIAPAATKAKPKFATLSD---------- 112
            |:...:.....|.|......||.:..:..:..|     :.|:....:...|.|.:          
 Frog    12 DDAGEEGEEDQGCSEDGGEVGAEREKEVELKDS-----LRPSVLDLQLALARLCEDEYRDQPSKM 71

  Fly   113 --MSKESSSDDDQQAFYAGGSDRSGQQVLGPPKRKNFREQLTDMMRSAQEQNIAEVGPSTSSGSA 175
              :..:.:.|...:..|:|.:     ::..|.|..|      ::.:.|:|.....:..::.    
 Frog    72 PVLGLQINEDHSFERSYSGNA-----KIPSPGKIVN------ELFKEAKEHGAIPIDDASK---- 121

  Fly   176 SGGSGGAVW------GQGMRLGMTDNDHTAVGTKKPAATIENKP--------VVVLKLWSQGFSI 226
               |.||.:      |:|.:||.:        :|:....|:.:.        .::|||||.|||:
 Frog   122 ---SSGAFYKARTFTGRGYKLGNS--------SKRELEYIQGEEPFEQGQEIQILLKLWSNGFSL 175

  Fly   227 DGGELRHYDDPQNKEFLETVMRGEIPQELLEM--GRMVNVDVEDHRHEDFKRQPVP-QTFKGSGQ 288
            |.||||.|.||.|.||||:|.:||||.||..:  |..||:|:|||:.:::.:..:. :.|.|.|:
 Frog   176 DDGELRSYSDPINAEFLESVKKGEIPVELQRLIHGGQVNLDMEDHQDQEYVKPRLKFKAFSGEGK 240

  Fly   289 KLGSPVANLVTEAPTVPVALSPGEAANQEASARDAINLNSEAPSTTLQIRLADGSRLAAQFNLSH 353
            ||||    |..|..:.|  .||.|...:..:|.  ::|:...|:|.:|||||||:||..:|||||
 Frog   241 KLGS----LTPEIISTP--SSPEEEHKRFLNAE--VDLDEHVPTTKIQIRLADGTRLIQRFNLSH 297

  Fly   354 TVSDIRRFIQTARPQYSTSNFILVSSFPTRELSDDNSTIEKAGLKNAALMQRLK 407
            .:.|:|.:|..||..::..:|.||::||..||:|::.|:|:|.:.|..::||||
 Frog   298 RIMDVRHYIIHARSDFAQCDFALVTTFPFVELTDESQTLEEADILNTVILQRLK 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p47NP_610284.1 UBA_ceTYDP2_like 6..42 CDD:270612
SEP 211..300 CDD:197786 43/99 (43%)
p47_UBX 329..407 CDD:176365 35/77 (45%)
ubxn2bXP_004915243.2 SEP 160..252 CDD:197786 44/95 (46%)
Ubiquitin_like_fold 270..351 CDD:421700 36/80 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8239
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1175850at2759
OrthoFinder 1 1.000 - - FOG0001623
OrthoInspector 1 1.000 - - otm47566
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X629
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.