DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and AT1G27200

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_564272.1 Gene:AT1G27200 / 839609 AraportID:AT1G27200 Length:575 Species:Arabidopsis thaliana


Alignment Length:260 Identity:57/260 - (21%)
Similarity:96/260 - (36%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TTTRSPVRLRLRNLRPASKKDDDKVVAVAHRLPATVCVDLVGFNMTSKFARNENALLQFFLFHQA 232
            ||...|...|:.......||  :|...|.|.|    ||..:.:|. :.|.|      ::.::|..
plant   264 TTPALPSVARIYGSDSIEKK--EKKSGVKHEL----CVCTMLWNQ-APFLR------EWIMYHSW 315

  Fly   233 LGIENFLVYNH---DELPEEVHHL-LERTNIHLYGLPFNFPFQQSNGTRSRIHQLLLTDCLLRNV 293
            ||:|.:.:|::   |.:.||:..| .|..|:..:..|:           .:..:...:.|.:|..
plant   316 LGVERWFIYDNNSDDGIQEEIELLSSENYNVSRHVWPW-----------IKTQEAGFSHCAVRAK 369

  Fly   294 NHAGFTLLLRPNEL-FFPNSKFSGDQVKGSLQQQLRHFSSEITRFELATMSVCFDDRKKLLPDNV 357
            ....:......:|. :||..:..|...|.:|:..:.:::|.....|:.|      |.....|..:
plant   370 EECNWVGFFDVDEFYYFPTHRSQGLPSKNALKSLVSNYTSWDLVGEIRT------DCHSYGPSGL 428

  Fly   358 ---------------QYDPER-----RSEFKT--LLNRLELPPAQLLASTSDVELSLSTGFVHRY 400
                           |.:|||     |.|..|  |||  |:...||......:.|..|...|:.|
plant   429 TSVPSQGVTVGYTCRQANPERHKSIIRPELLTSSLLN--EVHHFQLKEGVGHMSLVESVAVVNHY 491

  Fly   401  400
            plant   492  491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 20/114 (18%)
AT1G27200NP_564272.1 Glyco_transf_92 290..520 CDD:396317 49/232 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.