DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and GALS3

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_193750.1 Gene:GALS3 / 827763 AraportID:AT4G20170 Length:504 Species:Arabidopsis thaliana


Alignment Length:219 Identity:43/219 - (19%)
Similarity:75/219 - (34%) Gaps:71/219 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQQLVLLLISCLSVSILLMYKTENNRLKYVLKYVNFFGRNDAAVLRRLENGTKEDGAQVLWRPLP 68
            |....:::..||            :|.:::.|::.||..::                   :..:|
plant   316 YHNQFMIVNDCL------------HRYRFMTKWMFFFDVDE-------------------FLHVP 349

  Fly    69 VWQVIG---DSFHAYSAFW-----MRNELVAGGEAHVLVVGKKGAVVDFRCSLDLLGGRSVQ--- 122
            |.:.|.   :|...||.|.     |.:.:...|:.......|.|        ::.|..|.|:   
plant   350 VKETISSVMESLEEYSQFTIEQMPMSSRICYSGDGPARTYRKWG--------IEKLAYRDVKKVP 406

  Fly   123 ---GKFRFQRDSIESLVDDKSSNF--TSYHFFCQVSRDFGQPGSVSFTDITTTRSPVRLRLRNLR 182
               .|:..|.:::.:.....|.|.  .:||......|.|...||:|     ..|.|.| :|.|  
plant   407 RRDRKYAVQPENVFATGVHMSQNLQGKTYHKAESKIRYFHYHGSIS-----QRREPCR-QLFN-- 463

  Fly   183 PASKKDDDKVV--AVAHRLPATVC 204
                  |.:||  ...:.|..|:|
plant   464 ------DSRVVFENTPYVLDTTIC 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700
GALS3NP_193750.1 Glyco_transf_92 241..448 CDD:396317 29/170 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.