DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and AT3G27330

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_189369.1 Gene:AT3G27330 / 822354 AraportID:AT3G27330 Length:913 Species:Arabidopsis thaliana


Alignment Length:369 Identity:69/369 - (18%)
Similarity:133/369 - (36%) Gaps:105/369 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 WMRNELVAGGEAH-------VLVVGKKGAVVDFRCSLDLLGGRSVQGKFRFQRDSIESLVDDKSS 141
            |..::.:..|..|       ..|:....:.|.|...|:|..||                |.|.| 
plant   152 WTTDDHLPAGPTHRYDWLVYDAVIDYDNSTVVFVKGLNLRPGR----------------VADVS- 199

  Fly   142 NFTSYHFFCQVSRDFGQPGSVSFTDITT--------------------TRSPVRLRLR-----NL 181
                 .:.|....||.:...:..:|:.|                    .|.||::.:|     .:
plant   200 -----RYECVYGWDFAKHNRLIRSDVITAAQEIVRCRTPLAVLDGPKAARGPVKVSVRIKGGTGM 259

  Fly   182 RPASKKDDDKVVAVAHRLPATVCVDLVGFNMTSKFARNENALL-QFFLFHQALGIENFLVYNH-- 243
            .| |.....:::....:.|..:||    ..||    ||..|:| ::.::|..:|::.:.:|::  
plant   260 LP-SIAQPVRIINPPRKKPFQMCV----CTMT----RNAAAVLREWVMYHAGIGVQRWFIYDNNS 315

  Fly   244 -DELPEEVHHLLER-TNIHLYGLPFNFPFQQSNGTRSRIHQLLLTDCLLRNVNHAGFTLLLRPNE 306
             |::..|:.:|..| .||..:..|:           .:..:...::|.:|..:...:...:..:|
plant   316 DDDIIAEIENLERRGYNISRHFWPW-----------IKTQEAGFSNCAIRAKSDCDWIAFIDVDE 369

  Fly   307 LFF-PNSKFSGDQVKGSLQQQLRHFSSEITRFELATMSVCFDDRKKLLPDNVQYDPERRSEFKTL 370
            .|: |    ||:    :|...:|::::..:..|:.|....|.      |..::..| |.......
plant   370 FFYIP----SGE----TLTSVIRNYTTTDSIGEIRTPCHSFG------PSGLRSRP-RSGVTSGY 419

  Fly   371 LNRLELP--------PAQLLASTSDV--ELSLSTGFVHRYVDCD 404
            ..|:.||        |..:.|:..:|  ...|..||....:|.|
plant   420 TCRVVLPERHKSIIRPEAMNATLINVVHHFHLRDGFTFADMDKD 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 20/115 (17%)
AT3G27330NP_189369.1 Glyco_transf_92 276..486 CDD:279961 45/222 (20%)
RING 724..766 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.