DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and CG11384

DIOPT Version :10

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster


Alignment Length:122 Identity:27/122 - (22%)
Similarity:49/122 - (40%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 VCVDLVGFNMTSKFARNENALLQFFLFHQALGIENFLVYNHDELP--EEVHHLLERTN-IHL--- 261
            ||  |.||:.  .:......|:::|...:.||......|.:|..|  :.|....:||. :.|   
  Fly   274 VC--LKGFDF--PYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPL 334

  Fly   262 ---YGLP----FNFPFQQSNGTRSRIHQLL-LTDCLLRNVNHAGFTLLLRPNELFFP 310
               .|:|    :.....|......|:::|: ..||..||:....:.:.:..:|:..|
  Fly   335 TLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMP 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 PRK12323 347..>385 CDD:481241
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:426386 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.