DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and CG3655

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster


Alignment Length:442 Identity:90/442 - (20%)
Similarity:152/442 - (34%) Gaps:109/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WQVIGDS---FHAYSAFW-MRNELVAGGEAHVL-VVGKKGAVVDFRCSLDLLGGRS--VQGKFRF 127
            ||.:..|   |..:.|:: :|...:.|....:| ::.:....|...|.....|.:.  :...|.:
  Fly   129 WQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMIDRIEPKVKTYCQFWFDGQKEPFIVKTFEY 193

  Fly   128 QRDSIESLVDDKSSNFTSYHFFCQVSRDFG--QPGSVSFTDITTTRSPVRLRLRNLRPASKKDDD 190
            :........:.|...:..|...||:.:.|.  .|.|||..:.....:...||:...||    .||
  Fly   194 KYIWYNKWGNYKQGIYQPYLIACQIPKPFHGVVPSSVSMVEKECDTATNNLRVIYNRP----PDD 254

  Fly   191 KVVAVAHRLPATVCVDLVGFNMTSKFARNENALLQFFLFHQALGIENFLVYN---HDELPEEVHH 252
            :....|      |||..:.|.......|    |:::......||.:....||   |..:.:.::|
  Fly   255 QKKGFA------VCVKGLDFLYDDLSVR----LIEWIEMLNILGADKIYFYNLQVHPNITKVLNH 309

  Fly   253 LLERTNIHLYGLPFNFP--------FQQSNGTRSRIHQ-----LLLTDCLLRNVNHAGFTLLLRP 304
            ..:...:.:  :|...|        ||....|:...|:     :...|||.:|:....:..||..
  Fly   310 YEQEGKVQV--IPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDI 372

  Fly   305 NELFFPNSKFSGDQVKGSLQQQLRHFSSEIT-------RFELATMSVCF-DDRK------KLLPD 355
            :|:..|.   .|..:...|..::|..|.:|.       .|.    :|.| ||::      |.:|.
  Fly   373 DEVIMPK---GGAVLWSELMDKVRPESRKIKPDGFHSYNFR----NVYFLDDQQHEHGWHKDIPK 430

  Fly   356 NV----------------QY-----DPERRSEFKTLLNRLELPPAQLL--------ASTSDVELS 391
            .:                ||     ||||   ..||.|..   |...|        ..|.|.:|.
  Fly   431 YMHMLQHVHRAKNYTKPNQYVKCFHDPER---VLTLHNHF---PLSCLGGVCKSYPVDTKDAQLQ 489

  Fly   392 LSTGFVHRYVDCDHVGSDGLHDWRNAVREDFMEHINVLRNEVELLIQERTLR 443
                  |...||.........::    ||..:|...:.:.:.||:  .||::
  Fly   490 ------HYRADCVKTLKKSCEEY----REHSVEDKTIWKYKDELI--RRTIK 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 25/125 (20%)
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 61/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.