DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and K06H6.4

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_503251.3 Gene:K06H6.4 / 187073 WormBaseID:WBGene00019452 Length:500 Species:Caenorhabditis elegans


Alignment Length:296 Identity:54/296 - (18%)
Similarity:100/296 - (33%) Gaps:92/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VRLRLRNLRPASKKDDDKVVAVAHRLPATVCVDLVGFNMTSKFARNENALLQFFLFHQALGIENF 238
            :.:|..|.:| |..|..||.|:.   |.::      ||.|:.  .||:.|               
 Worm    37 IGIRNHNWKP-STTDLTKVAALP---PESL------FNTTTD--ENEDPL--------------- 74

  Fly   239 LVYNHDELPEEVHH-----LLERTNIHLYGL--------PFNF--------PFQQSN------GT 276
            ..||..:.|.|..:     ::..|.:|...:        ||.:        .|.|.:      .:
 Worm    75 FAYNSFDCPYEEWNQVTTTIIPNTEVHENWMRSWKPEKQPFLYHTKPSAMSAFAQKDQIVVALTS 139

  Fly   277 RSRIHQLLLT---DCLLRNVNHAGFTLLLRPNELFF---PNSKFSGDQVKGSLQQQLRHFSSEIT 335
            .|.|:..:..   ||..|.::.....::...:.:|.   ||:|:.   ...:...:...:|..|.
 Worm   140 ASLINSTMYCRYYDCRRREISDPFQNVIFHKSTVFCALRPNAKYI---AVSATSDETPEYSVPIV 201

  Fly   336 -------RFELATMSVCFDDRKKLLP--DNVQYDPERRSEFKTLLNRLELPPAQLLASTSDVELS 391
                   .:....|:..:.|..|.|.  |.::|...:.:.|..:          .|.:.:|.:..
 Worm   202 PRINKPPHYFTVCMAPLYGDEPKFLQIVDFIEYHKLQGATFFHI----------YLRNVTDYDRM 256

  Fly   392 LSTGFVHRYVDCDHVGSDGLHD--WRNAVREDFMEH 425
            :    :..||....:....:||  |    |.|:|.|
 Worm   257 M----LDEYVKTGDIEIIKMHDHFW----RADYMWH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 21/142 (15%)
K06H6.4NP_503251.3 Glyco_transf_92 209..454 CDD:366762 18/94 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.