DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and F46F5.7

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_493820.1 Gene:F46F5.7 / 185860 WormBaseID:WBGene00018498 Length:465 Species:Caenorhabditis elegans


Alignment Length:298 Identity:52/298 - (17%)
Similarity:100/298 - (33%) Gaps:95/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GRSVQGK-------FRFQRDSIESLVDDKSSNFTSYHFFCQVSRDFGQPGSVSFTDIT----TTR 171
            |||.:..       :.|:.   |..|...|.|...:..:|:...|......:.|..:|    ...
 Worm   102 GRSKRASNISTLFAYEFEH---EITVTTTSWNRMGHRVYCRYLDDNNVEIGIPFESLTYPEYIAS 163

  Fly   172 SPVRLRLRNLRPASKKDDDKV-VAVAHRL------PATVCVDLVGFNMTSKFARNENALLQF--F 227
            ...|...|.:..:.::|.|.| :.:..|:      ..::|:        :....:|...|.|  .
 Worm   164 CKKREGTRKIGLSVERDGDFVPLPIIDRMLKKPKYELSMCI--------ASIYGDEPKWLMFIEL 220

  Fly   228 LFHQAL-GIENFLVYNH----------------DELPEEVHHLLE---RTNIHLYGLPFNFPFQQ 272
            :.|..| |:::|.::.|                .|:  |||:|:|   ||:.|.           
 Worm   221 IEHYKLQGVQHFYLHIHHASEYDMAVINDYVRTGEV--EVHYLIERDMRTDDHW----------- 272

  Fly   273 SNGTRSRIHQLLLTDCLLRNVNHAGFTLLLRPNELFFPNSKFSGDQVKGSLQQQLRHFSSEITRF 337
                    ..:.:.|||:.:.....:|:....:|..:..:      ..|::...:|...:|    
 Worm   273 --------QMVSIADCLIWSRGETKWTIFADLDERIYMTN------YTGTILDYVRDIKNE---- 319

  Fly   338 ELATMSVCFDD----RKKLLPDNVQYD-------PERR 364
              :..|:.|..    :.:|.|...:.|       |.||
 Worm   320 --SIASIQFRQQWIMKTELTPPKYEGDGQLDKWMPTRR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 23/131 (18%)
F46F5.7NP_493820.1 Glyco_transf_92 198..448 CDD:366762 34/199 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.