DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and F28H7.7

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_505744.1 Gene:F28H7.7 / 185098 WormBaseID:WBGene00009240 Length:415 Species:Caenorhabditis elegans


Alignment Length:271 Identity:52/271 - (19%)
Similarity:89/271 - (32%) Gaps:90/271 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 LLQFFLFHQALGIENFLVYNHD----ELPEEVHHLLERTNIHLYGLP---FNFPFQQSNGTRSRI 280
            |::....::..|:..|..|..:    ::....|::..|..:.:..:|   |:...||        
 Worm   170 LVEMIEHYKLQGVTKFYFYIREIELYDMSVLQHYMAFRDEVEIIHIPSIYFDAVSQQ-------- 226

  Fly   281 HQLLLTDCLLRNVNHAGFTLLLRPNE-LFFPNSK-----FSGDQVK----GSLQQQLRHFSSE-- 333
             .|.:.||.|||...|.:|:....:| :...:||     |..|.|.    |.:..|...|..|  
 Worm   227 -YLAIADCHLRNQLSANWTIFSDIDERIILTDSKTTIRNFLQDSVSEKYGGVMFPQRWIFKYEKL 290

  Fly   334 ---------------ITRFELATM--------SVCFD----DRKKLLPDNVQYDPERRSEFKTLL 371
                           ..::||.|.        ..||.    :.:|:|...:....|....::||:
 Worm   291 PEKFINPVQIMQEMPSRKWELTTQPWLNCTDGKHCFSKMIVNNQKVLQMMIHDVGEYNGNYQTLI 355

  Fly   372 NRLELPPAQLLASTSDVELSLSTGFVHRYVDCDHVGSDGLHDW--RNAVREDFMEHINVLRNEVE 434
                              |....|::..|.|.:      :..|  ||   :|.:|.:....|.. 
 Worm   356 ------------------LDPKIGYIRHYRDVN------MGKWWVRN---KDVLEKLKPYENTT- 392

  Fly   435 LLIQERTLRLR 445
                 ..||||
 Worm   393 -----YNLRLR 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 27/126 (21%)
F28H7.7NP_505744.1 Glyco_transf_92 151..401 CDD:366762 52/271 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.