Sequence 1: | NP_610283.1 | Gene: | CG11127 / 35673 | FlyBaseID: | FBgn0033178 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505096.1 | Gene: | D1014.6 / 183897 | WormBaseID: | WBGene00017019 | Length: | 477 | Species: | Caenorhabditis elegans |
Alignment Length: | 271 | Identity: | 51/271 - (18%) |
---|---|---|---|
Similarity: | 82/271 - (30%) | Gaps: | 123/271 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 ENALLQFFLFHQALGIENFLVYNHDELPEEVHH-------LLERTNIHLYGLPFNFPFQQSNGTR 277
Fly 278 SRIHQLLLTDCLLRNVNHAGFTLLLRPNELFFPNSKFSGDQVKGSLQQQLRHFSSEITRFELATM 342
Fly 343 SVCFDDRKKLLPD-----------------------NVQYDPERRSEFK-TLLNRLELPP----- 378
Fly 379 ------------AQLLASTSDVELSLSTGFVHRYV----DCDHVGSDG-----------LHD--W 414
Fly 415 RNAVREDFMEH 425 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11127 | NP_610283.1 | Glyco_tranf_GTA_type | 223..>333 | CDD:299700 | 21/116 (18%) |
D1014.6 | NP_505096.1 | Glyco_transf_92 | 210..455 | CDD:366762 | 17/81 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR21461 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |