DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and C08B6.3

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_505599.2 Gene:C08B6.3 / 182389 WormBaseID:WBGene00007424 Length:439 Species:Caenorhabditis elegans


Alignment Length:247 Identity:46/247 - (18%)
Similarity:85/247 - (34%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RPLPVWQVIG-DSFHAYSAFWMRNELVAGGEAHVLVVGKKGAV---VDFRCSLDLLGGRSVQGKF 125
            :.||.:::.. |.|..|:..| :.|:.......:..|....|.   |::..|:      :..||:
 Worm    50 KELPTYKIDRMDRFEWYTRKW-KEEIKKDQPPKIEEVSMLRAYEFDVEYSISI------TTPGKY 107

  Fly   126 R-------FQRDSIESLVDDKSSNFTSYHFFCQVSRDFGQPGSVSFTDITTTRSPVRLRLRNLRP 183
            :       |....:|.|...:|.||..:...|| .|...:..|||.........|:.|..|..|.
 Worm   108 KAILYCRYFDESGVELLPSFQSYNFPEFVVNCQ-KRKGTKRVSVSTQATNNYTYPIELHDRTQRE 171

  Fly   184 ASKKDDDKVVAVAHRLPATVCVDLVGFNMTSKFARNENALL--QFFLFHQALGIENFLVYNHDEL 246
            ..::                    :.|.|:..:.:....||  :....::..|:.:|..|     
 Worm   172 YKRE--------------------LSFCMSPIYGKEAKWLLLAEIIEHYKLQGMTHFYFY----- 211

  Fly   247 PEEVHHLLERT----NIHLYGLPFNFPFQQSNGTRSRIH--QLLLTDCLLRN 292
               :.|:.|.:    |.::........:.|....|..:|  .:...||.||:
 Worm   212 ---IFHIDEYSSAMLNDYVRTGEVEVTYLQERNDRELLHWQMVAFRDCTLRS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 15/78 (19%)
C08B6.3NP_505599.2 Glyco_transf_92 174..419 CDD:366762 17/115 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.