DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11127 and T06A1.5

DIOPT Version :9

Sequence 1:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_503534.1 Gene:T06A1.5 / 178674 WormBaseID:WBGene00020280 Length:476 Species:Caenorhabditis elegans


Alignment Length:410 Identity:78/410 - (19%)
Similarity:123/410 - (30%) Gaps:158/410 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VVGKKGAVVDFRCSLDLLGGRSVQGKFRFQRDSIESLVDDKSSNFTSYHFFCQVSRDFGQPGSVS 163
            ||..:.|:..||.....:.|.|..|..:||..:..|..|         ||...:|.. .|.|||:
 Worm    91 VVNGEPALAYFRKLSGSVNGFSSAGGLKFQIMAAYSYKD---------HFSATISVP-KQIGSVA 145

  Fly   164 F-----TDITTTRSPVRLRLRNLRPASKKDDDKVVAVAHRLPATVCVDLVGF-NMTSKFARNENA 222
            :     .|......||..|:...         .||..:.|..||    ::|. |..::....||:
 Worm   146 YCRYIGVDGKEVAEPVESRVYPF---------FVVYCSRRSNAT----MLGITNSKNEPISTENS 197

  Fly   223 LLQFFLFHQALGIENFLVYNHD-------------------ELPEEVHHLLERTN--------IH 260
            ..   |.|:     .|..|.|:                   ||.|  |:.|:..|        |.
 Worm   198 AK---LIHR-----KFKEYQHNVSFCLAPIYGKEPKWLHFAELVE--HYKLQGVNKFFIYIREIG 252

  Fly   261 LYGLPFNFPFQQSN--------GTRSRI---HQLLLTDCLLRNVNHAGFTLLLRPNE-------- 306
            .|.:.....:..|.        .|.|.:   ..:.:.|||||:..::.:::....:|        
 Worm   253 EYDMKLVKSYVASGEVEIIEVPATNSDVIAQQMMAVADCLLRSRTYSKWSIYADIDERLIMTDDR 317

  Fly   307 -----------------LFFPN----------SKFSGD-QVKGSLQQQLRHFSSEITRFELATMS 343
                             :.||.          .||:.| |:...:..:..|   |.|...:....
 Worm   318 MTINGFLRNVTDESIGSIAFPQRWIMKREQIPPKFTSDAQIIEKMPTRAWH---ETTSAAMKGHP 379

  Fly   344 VCFDD--------------RKKLLPDNVQYDPERRSEFKTLLNRLELPPAQLLASTSDVELSLST 394
            ||.|.              .:.|:.:.|::.|..|..|                      |..|.
 Worm   380 VCKDQVSCWAKDIVHNEKAIRMLVHEVVKFYPGYREWF----------------------LDSSI 422

  Fly   395 GFVHRYVDCDHVGSDGLHDW 414
            |::..|.|.|      :..|
 Worm   423 GYIRHYRDVD------MQSW 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 29/183 (16%)
T06A1.5NP_503534.1 Glyco_transf_92 210..463 CDD:366762 42/260 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.