DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and ERG25

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_011574.3 Gene:ERG25 / 852951 SGDID:S000003292 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:53/246 - (21%)
Similarity:76/246 - (30%) Gaps:113/246 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 YLEMCTKTPWWL---VPLF--W--IPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGVLLWSFLEY 213
            |...|  .||::   :|.|  |  .|..:..|.|:.               |.|..|||..||..
Yeast    66 YFFRC--LPWFIIDQIPYFRRWKLQPTKIPSAKEQL---------------YCLKSVLLSHFLVE 113

  Fly   214 TLHRWVFH---VKLSNKSGSWLCTFHFMIHGLHHKVPFDPMRLVFPPLPGAVLAAVIYTPLSFVL 275
            .:..|.||   .||                |:..:|||..::.:           .:...|.|||
Yeast   114 AIPIWTFHPMCEKL----------------GITVEVPFPSLKTM-----------ALEIGLFFVL 151

  Fly   276 SHPRVILSGALAGYLCYDMMHYY----LHYGNPSLWAFVHMKRYHHHHH-----------FSHQ- 324
            .                |..||:    .|||       |..|..|..||           ::|. 
Yeast   152 E----------------DTWHYWAHRLFHYG-------VFYKYIHKQHHRYAAPFGLSAEYAHPA 193

  Fly   325 ---TLGYG-ISSPLWDVVFKTRIHLRKL----------------RYQLRWS 355
               :||:| :..|:..|::..::||..|                .|...||
Yeast   194 ETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYDFPWS 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 47/214 (22%)
ERG25NP_011574.3 ERG3 35..307 CDD:225546 53/246 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.