DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and SUR2

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_010583.1 Gene:SUR2 / 851891 SGDID:S000002705 Length:349 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:72/336 - (21%)
Similarity:120/336 - (35%) Gaps:94/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GLNSGDMTARFLKAPPHSDAAMYLMREYKIDPEDSRKPKSSQR---------------------E 87
            ||.:......:.|||           ...:.|::|..|:.|..                     :
Yeast    18 GLKTSFGFMHYAKAP-----------AINLRPKESLLPEMSDGVLALVAPVVAYWALSGIFHVID 71

  Fly    88 TLHHDEDGTLRQRPRETEDKNNNQ------VDDSMEHLVDWSKAMLPQIANITDCYDEWVHKPVD 146
            |.|..|  ..|..|.|...|.|..      ::..::|::.....::            ::|    
Yeast    72 TFHLAE--KYRIHPSEEVAKRNKASRMHVFLEVILQHIIQTIVGLI------------FMH---- 118

  Fly   147 RPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEFTTAWQDSNQLAVFSGYFLFGVLLWSFL 211
                 |:|.|:....:...|.:......:|...|:  :.......:.|.:|:| ||| |..|   
Yeast   119 -----FEPIYMTGFEENAMWKLRADLPRIIPDAAI--YYGYMYGMSALKIFAG-FLF-VDTW--- 171

  Fly   212 EYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHK--VPFDPMRLVFPPLPGAVLAAVIYTPLSFV 274
            :|.||| :.|:   ||      |.:...|.:||:  ||:....|...|:.|.:| ..:.|.::..
Yeast   172 QYFLHR-LMHM---NK------TLYKWFHSVHHELYVPYAYGALFNNPVEGFLL-DTLGTGIAMT 225

  Fly   275 LSH----PRVILSGALAGYLCYDMMHYYLHYGNPSLWAFVHMKRYH--HHHHFSHQTLGYGISSP 333
            |:|    .::||..........|...|.|.. :|..|.|.:...||  ||..|..:|   ..:.|
Yeast   226 LTHLTHREQIILFTFATMKTVDDHCGYALPL-DPFQWLFPNNAVYHDIHHQQFGIKT---NFAQP 286

  Fly   334 ---LWDVVFKT 341
               .||.:|:|
Yeast   287 FFTFWDNLFQT 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597 5/28 (18%)
FA_hydroxylase 117..341 CDD:294712 54/234 (23%)
SUR2NP_010583.1 ERG3 40..337 CDD:225546 66/303 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.