DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and FAH2

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001328972.1 Gene:FAH2 / 827835 AraportID:AT4G20870 Length:237 Species:Arabidopsis thaliana


Alignment Length:233 Identity:96/233 - (41%)
Similarity:139/233 - (59%) Gaps:21/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 HLVDWSKAMLPQIANITDCYDEWVHKP---VDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKC 179
            :.||.:|.::.|:.::.:.|.||:|:|   |:.| |.|:..:.|..|:|.||.:|..|:||:  |
plant     6 YTVDLNKPLVFQVGHLGEEYQEWIHQPIVCVEGP-RFFESDFWEFLTRTVWWAIPTIWLPVV--C 67

  Fly   180 AVEEFTTAWQDSNQLAVFSGYFL---FGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHG 241
            .|...:     :::...|....|   ||||.|:.|||||||::||::..:   .|..|.|:::||
plant    68 YVLSIS-----ASKGLTFPQIGLIVAFGVLTWTLLEYTLHRFLFHIQTKS---YWANTAHYLLHG 124

  Fly   242 LHHKVPFDPMRLVFPPLPGAVLAAVIYTPLSFVLSHPR---VILSGALAGYLCYDMMHYYLHYGN 303
            .|||.|.|.:||||||...|:|...:: .|..:|:.|.   .||.|.|.||:.||:.|||||:|.
plant   125 CHHKHPQDGLRLVFPPTATAILLVPLW-KLLHLLATPATAPAILGGILFGYVMYDITHYYLHHGQ 188

  Fly   304 PSLWAFVHMKRYHHHHHFSHQTLGYGISSPLWDVVFKT 341
            |....|.|:|:||.:|||..|..||||:|.|||.||.|
plant   189 PKEPTFKHLKKYHLNHHFRIQDKGYGITSSLWDKVFGT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 95/231 (41%)
FAH2NP_001328972.1 PLN02434 1..237 CDD:178053 96/233 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1503
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I1461
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1049908at2759
OrthoFinder 1 1.000 - - FOG0004076
OrthoInspector 1 1.000 - - otm3094
orthoMCL 1 0.900 - - OOG6_103477
Panther 1 1.100 - - O PTHR12863
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2828
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.