DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and FAH1

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_181023.1 Gene:FAH1 / 818042 AraportID:AT2G34770 Length:237 Species:Arabidopsis thaliana


Alignment Length:232 Identity:90/232 - (38%)
Similarity:129/232 - (55%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VDWSKAMLPQIANITDCYDEWVHKPV---DRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAV 181
            ||..|.::.|:.::.:.|:||||:|:   :.| |.|...:.|..|.|.||.||:.|:||:|.|..
plant     8 VDLKKPLVFQVGHLGEDYEEWVHQPIATKEGP-RFFQSDFWEFLTLTVWWAVPVIWLPVVVWCIS 71

  Fly   182 EEFTTAWQDSNQLAVFSGYFLFGVLLWSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHHKV 246
            ...:...    .|.......:.|:.:|:|.||.|||:|||:|..:   .|..|.|::|||.|||.
plant    72 RSVSMGC----SLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKS---YWGNTAHYLIHGCHHKH 129

  Fly   247 PFDPMRLVFPPLPGAVL-------AAVIYTPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNP 304
            |.|.:||||||...|:|       |..|.||     |....:..|.:.||:.||:.|||||:..|
plant   130 PMDHLRLVFPPTATAILCFPFWNIAKAISTP-----STAPALFGGGMLGYVMYDVTHYYLHHAQP 189

  Fly   305 SLWAFVHMKRYHHHHHFSHQTLGYGISSPLWDVVFKT 341
            :.....::|:||.:|||..|..|:||:|.|||:||.|
plant   190 TRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 89/230 (39%)
FAH1NP_181023.1 PLN02434 1..237 CDD:178053 90/232 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1503
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56284
Inparanoid 1 1.050 180 1.000 Inparanoid score I1461
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1049908at2759
OrthoFinder 1 1.000 - - FOG0004076
OrthoInspector 1 1.000 - - otm3094
orthoMCL 1 0.900 - - OOG6_103477
Panther 1 1.100 - - LDO PTHR12863
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2828
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.