DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and Msmo1

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_079712.1 Gene:Msmo1 / 66234 MGIID:1913484 Length:293 Species:Mus musculus


Alignment Length:250 Identity:51/250 - (20%)
Similarity:82/250 - (32%) Gaps:97/250 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VDWSKAMLPQIANITDCYDEWVHKPVDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAVEEF 184
            |::..::||:             .|:..|.:  :.|...:...|.:.:..  |..:||..|:   
Mouse    17 VEYVDSLLPE-------------NPLQEPFK--NAWVYMLDNYTKFQIAT--WGSLIVHEAI--- 61

  Fly   185 TTAWQDSNQLAVFSGYFLFGV--LLWSFLEYTLHRWVFHVKLSNKSGSWLCT-----FHFMIH-- 240
                           ||||.:  .|:.|:.|.....:...|.....|.|.|.     .||.|.  
Mouse    62 ---------------YFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFNHFFIQLP 111

  Fly   241 ---GLHH-----KVPFDPMRLVFPPLPGAVLAAVIYTPLSFVLSHPR--VILSGALAGYLCYDMM 295
               |.::     .:|:|..|:                        ||  :.|:..|...:..|..
Mouse   112 LICGTYYFTEFFNIPYDWERM------------------------PRWYLTLARCLGCAVIEDTW 152

  Fly   296 HYYLHYGNPSLWAFVHMKR---YHH--HHHFSHQTLGYGISS----PLWDVVFKT 341
            ||:||       ..:|.||   |.|  ||.|.   ..:||.:    ||..::..|
Mouse   153 HYFLH-------RLLHHKRIYKYIHKVHHEFQ---APFGIEAEYAHPLETLILGT 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 50/248 (20%)
Msmo1NP_079712.1 FA_hydroxylase 143..274 CDD:397991 18/64 (28%)
Histidine box-1 157..161 1/10 (10%)
Histidine box-2 170..174 1/3 (33%)
Histidine box-3 249..255
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.