DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and MSMO1

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_006736.1 Gene:MSMO1 / 6307 HGNCID:10545 Length:293 Species:Homo sapiens


Alignment Length:296 Identity:57/296 - (19%)
Similarity:95/296 - (32%) Gaps:90/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DGTLRQRPRETEDKN------NNQVDDSMEHLVDWSKAMLPQIANITDCYDEWVHKPV------- 145
            |..|.:.|.:...||      ||.   :...:..|...::.:......|...::.:.:       
Human    21 DSLLPENPLQEPFKNAWNYMLNNY---TKFQIATWGSLIVHEALYFLFCLPGFLFQFIPYMKKYK 82

  Fly   146 ---DRPLRLFDPW-------YLEMCTKTP----------WWLVPLFWIPVIVKCAVEEFTTAWQD 190
               |:|....:.|       :...|.:.|          ::.:|..|          |....|  
Human    83 IQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDW----------ERMPRW-- 135

  Fly   191 SNQLAVFSGYFL----FGVLL----WSFLEYTLHRWVFHVKLSNKSGSWLCTFHFMIHGLHH--K 245
                     |||    ||..:    |   .|.|||.:.|.::           :..||.:||  :
Human   136 ---------YFLLARCFGCAVIEDTW---HYFLHRLLHHKRI-----------YKYIHKVHHEFQ 177

  Fly   246 VPFDPMRLVFPPLPGAVLAAVIYTPLSFVLSHPRVILSGALAGYLCYDMMHYYLHYGNP----SL 306
            .||........||...:|....:..:..:..|  |||..|.......:.:..:..|..|    :|
Human   178 APFGMEAEYAHPLETLILGTGFFIGIVLLCDH--VILLWAWVTIRLLETIDVHSGYDIPLNPLNL 240

  Fly   307 WAFVHMKRYHHHHHFSHQTLG-YGISSPLWDVVFKT 341
            ..|....|:|..||.:.  :| |..:...||.:|.|
Human   241 IPFYAGSRHHDFHHMNF--IGNYASTFTWWDRIFGT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 49/265 (18%)
MSMO1NP_006736.1 ERG3 60..274 CDD:225546 48/252 (19%)
Histidine box-1 157..161 2/3 (67%)
Histidine box-2 170..174 1/3 (33%)
Histidine box-3 249..255 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.