DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fa2h and ch25h

DIOPT Version :9

Sequence 1:NP_610279.3 Gene:fa2h / 35670 FlyBaseID:FBgn0050502 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001008652.1 Gene:ch25h / 494109 ZFINID:ZDB-GENE-041212-81 Length:251 Species:Danio rerio


Alignment Length:284 Identity:52/284 - (18%)
Similarity:88/284 - (30%) Gaps:112/284 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 IANITDC---YDEWVHKPVDRPLRLFDPWYLEMCTKTPWWLVPLFWIPVIVKCAV---------- 181
            :.:|.||   |:..:..|. .|:......||..|            :|.::..|:          
Zfish     4 LQHIWDCILQYEAQLRSPF-FPVLFSITVYLSFC------------LPFVLLDALSPKVELIRRY 55

  Fly   182 ---EEFTTAWQDSNQLAVFSGYFLFGVLLWSFLEYTLHRWVFHV-KLSNKSGSW----------- 231
               ::.:.:|                .::||.|..:|:..|.:: .||.....|           
Zfish    56 KIQQKASVSW----------------TMMWSCLALSLYNHVVYIFPLSVLHWYWRPVSYLAEAPG 104

  Fly   232 -----------LCTF---HFMIHGLHHKVP--FDPMRLVFPPLPGAVLAAVIYT------PLSFV 274
                       |..|   :|:.|.||||||  :.....|..........|..|:      .|.|.
Zfish   105 VLRVVWDLAACLLLFDFQYFVWHLLHHKVPWLYRTFHKVHHKYTSTFALATEYSGAWETLSLGFF 169

  Fly   275 LSHPRVILSGALAGYLCYDMMHYYL----HYGNPSLWAFVHMKRY-------HH--HH------- 319
            .:...::|.......:.:.|::.:|    |.|....||...:..:       ||  ||       
Zfish   170 AAVNPMLLGVHPMTEMLFHMLNMWLSVEDHCGYDLPWATHRLMPFGLYGGAPHHDVHHQKFKSNY 234

  Fly   320 --HFSHQTLGYGISSPLWDVVFKT 341
              :|:|           ||.:|.|
Zfish   235 APYFTH-----------WDKLFGT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fa2hNP_610279.3 Cyt-b5 6..73 CDD:278597
FA_hydroxylase 117..341 CDD:294712 51/282 (18%)
ch25hNP_001008652.1 FA_hydroxylase 112..247 CDD:309300 31/145 (21%)
Histidine box-1 126..130 1/3 (33%)
Histidine box-2 141..145 1/3 (33%)
Histidine box-3 222..228 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.